KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_61750Help
Entry
PA14_61750        CDS       T00401                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA14_61750 (ipk)
Enzymes [BR:pau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PA14_61750 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5509336..5510184
Genome map
AA seq 282 aa AA seqDB search
MSVRLSLPAPAKLNLFLHILGRRDDGYHELQTLFQFLDHGDELHFEARQDGQVRLHTEIA
GVPHDSNLIVRAARGLQEASGSLQGVDIWLDKRLPMGGGIGGGSSDAATTLLALNHLWQL
GWDEDRIAALGLRLGADVPVFTRGRAAFAEGVGEKLTPVDIPELWYLVLVPQVLVSTAEI
FSDPLLTRDSPAIKVRTVLEGDSRNDCQPVVERRYPEVRNALILLNKFVSARLTGTGGCV
FGSFPNKAEADKVSALLPDHLQRFVAKGSNVSMLHRKLETLV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgcctcagcctgccagccccggccaagctcaatctgttcctgcatatccta
ggccgccgcgacgatggctatcacgagttgcagaccctgttccaattcctcgaccacggc
gacgagctgcatttcgaagcccgccaggacggccaggtacgcctgcacacggaaatcgcc
ggggtgccgcacgacagcaacctgatcgtgcgcgccgcgcgcgggctgcaggaagcctcc
ggcagcctgcaaggcgtcgacatctggctggacaagcgcttgcccatggggggcggcatc
ggcggcggcagctccgacgccgccacgacgctcctggccttgaaccatctctggcaactc
ggctgggacgaggaccgcatcgccgccctgggcctgcgcctgggcgccgacgtgccggtc
ttcacccgcggacgcgcggctttcgccgagggcgtgggcgaaaagctcaccccggtggac
atcccggagctctggtatctcgtcttggttccgcaagtacttgtcagcacagcagaaatt
ttttcagatccactgttgacacgcgattctcccgccattaaagtgcgcaccgttctcgag
ggggacagccgaaacgactgtcagccggtagtcgagaggcgttacccagaagttcgtaac
gctttgatcttgctaaacaaatttgtttcagctagattaaccggcactggaggttgtgtg
tttgggagcttcccaaacaaagctgaagctgataaagtctcggcccttcttccagaccac
cttcagaggttcgtcgccaaaggaagcaacgtctcgatgttgcaccggaagctggaaact
ctggtctga

DBGET integrated database retrieval system