KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_62830Help
Entry
PA14_62830        CDS       T00401                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PA14_62830 (tpiA)
   01230 Biosynthesis of amino acids
    PA14_62830 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA14_62830 (tpiA)
   00051 Fructose and mannose metabolism
    PA14_62830 (tpiA)
   00562 Inositol phosphate metabolism
    PA14_62830 (tpiA)
Enzymes [BR:pau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PA14_62830 (tpiA)
Exosome [BR:pau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PA14_62830 (tpiA)
  Exosomal proteins of bladder cancer cells
   PA14_62830 (tpiA)
  Exosomal proteins of melanoma cells
   PA14_62830 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5604675..5605430)
Genome map
AA seq 251 aa AA seqDB search
MRRPLVAGNWKMHGTHSSVAELIKGLRQLALPSGVDVAVMPPCLFISQVIQGLAGKAIDV
GAQNSAVEPMQGALTGETAPSQLADVGCSMVLVGHSERRLILGESDEVVSRKFAAAQSCG
LVPVLCVGETRAEREAGKTLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASP
AQAQEVHAAIRAQLAAENAEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNAD
EFGAICRAAGS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgacccttggtggccggtaactggaaaatgcacggtacgcattccagtgtggcc
gagttgatcaaaggcttgcgtcagctggcgttgccgagcggagtcgatgtagctgtgatg
ccgccttgcttgttcatcagccaggtcatccagggcctggccggcaaggcgatcgatgta
ggtgcgcagaacagcgccgtcgagccgatgcaaggcgcgctgaccggtgagactgctccc
agtcagttggcggatgtcggttgtagcatggtccttgtgggccactcggagcgtcgcctg
attctcggcgagagtgacgaggttgtgagtcgcaagtttgccgcggctcagtcgtgcggc
ctggtgccggtgctgtgtgtcggggaaacccgggcggagcgcgaggcgggcaagacgctg
gaggttgtcgcaaggcagctgggaagcgtgatcgacgagttgggtgttggagcttttgct
cgcgcagtcgtggcttacgagccggtctgggcgatcgggaccgggttgaccgcgtccccc
gcgcaagcccaggaagtgcacgcggcgatccgcgcgcaactggcagcggaaaatgccgag
gtcgcaaaaggtgtgcgactcctttacggcggcagtgtaaaggcggcaagtgcagccgag
ttgttcggcatgccggatatcgatggggggctggtaggtggagcctccctcaatgcggat
gagttcggcgcgatctgtcgtgccgcgggaagctga

DBGET integrated database retrieval system