KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_63250Help
Entry
PA14_63250        CDS       T00401                                 

Gene name
yfcY
Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA14_63250 (yfcY)
   00630 Glyoxylate and dicarboxylate metabolism
    PA14_63250 (yfcY)
   00640 Propanoate metabolism
    PA14_63250 (yfcY)
   00650 Butanoate metabolism
    PA14_63250 (yfcY)
  Lipid metabolism
   00071 Fatty acid degradation
    PA14_63250 (yfcY)
   00072 Synthesis and degradation of ketone bodies
    PA14_63250 (yfcY)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA14_63250 (yfcY)
   00310 Lysine degradation
    PA14_63250 (yfcY)
   00380 Tryptophan metabolism
    PA14_63250 (yfcY)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA14_63250 (yfcY)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA14_63250 (yfcY)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA14_63250 (yfcY)
Enzymes [BR:pau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PA14_63250 (yfcY)
Exosome [BR:pau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA14_63250 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5644360..5645637)
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIVGGNRIPFARSNTVYATASNQEMLTSALEGLVERYNLHGERLGEVVAGAVL
KHSRDFNLTRECVLGSRLAPETPAYDIQQACGTGLEAAILVANKIALGQIDSGIAGGVDT
TSDAPIGVNEGLRKILLEANRGKSNLDKLRSLLKIRPRHVVPAIPRNGEPRTGLSMGESC
ELMAQTWQIPRDEQDRLAFESHHKLAAAYEEGWQNDLMTPFRGLTRDQNLRPDIDLEKIG
TLKPVFERGSRGTLTAANSTPLTDGASVVLLASEEWAKARGLPILAYFKDGEAAAVNFVD
RQEGLLMAPVYAVPRLLARNGLSLQDFDYYEIHEAFAAQVLCTLKAWEDPEYCKTRLGLD
QPLGSIDRSKLNVKGSSLAAGHPFAATGGRIVANLAKLLSVAEQGRGLISICAAGGQGVT
AIIER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctgcgccgggtcgccattgtcggcggcaaccgtattcccttcgcccgctcg
aacaccgtgtacgccacggcgagcaaccaggagatgctcacttccgccctggaaggcctg
gtggagcgctacaacctgcatggcgagcgtcttggcgaggtggtggccggcgccgtgctg
aagcattcgcgcgacttcaacctgacccgcgaatgcgtgctcggttcgcgcctggccccg
gaaaccccggcctacgatatccagcaggcctgcggtaccggcctggaggcggcgatcctg
gtggccaacaagatcgccctcgggcagatcgacagcggcatcgccggcggcgtcgacacc
acttccgacgcgccgatcggggtcaacgagggtctgcgcaagattctcctcgaggccaac
cgtggcaagagcaacctggacaagctcaggagcctattgaagatccgcccgcgccacgtg
gtcccggccatcccgcgcaacggcgagccgcgcaccgggctgtcgatgggggagtcctgc
gaactgatggcgcagacctggcagattccccgcgacgagcaggacaggctggccttcgag
agccaccacaagctggccgcggcctatgaggaaggctggcagaacgacctgatgacgccg
ttccgcggcctgacccgcgaccagaacctgcgcccggatatcgacctggagaagatcggc
accctcaagccggtgttcgagcgcggctcgcgcggcaccctcacggcggccaactcgacg
ccgctgaccgacggcgcctcggtggtactgctggccagcgaggagtgggcgaaggcgcgc
ggcctgccgatcctggcctacttcaaggacggcgaggcggcggcggtgaacttcgtcgat
cgccaggagggcctgctgatggcgccggtctacgcggtgccgcggctgctggcacgcaac
ggcctgagcctgcaggacttcgactactacgagatccacgaggccttcgccgcccaggtg
ctctgcaccctgaaggcctgggaagaccccgagtactgcaagacccgtctcggcctcgac
cagccgctgggctccatcgaccgcagcaagctcaacgtcaagggcagctcgctggccgcc
ggccacccgttcgccgccacgggaggacggatcgtcgccaacctggccaagctgctctcg
gtggcggagcagggacgcgggctgatttccatctgcgccgccggtgggcagggtgtgacc
gcgatcatcgagcggtaa

DBGET integrated database retrieval system