KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_68370Help
Entry
PA14_68370        CDS       T00401                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PA14_68370 (cysQ)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PA14_68370 (cysQ)
Transfer RNA biogenesis [BR:pau03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PA14_68370 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6100299..6101120)
Genome map
AA seq 273 aa AA seqDB search
MRPVPWGELVALVRRAGEAILPHWRADVAVRSKADESPVTAADLAAHHILEAGLRALAPD
IPVLSEEDCEIPLSERGHWRRWWLVDPLDGTKEFISGSEEFTVNVALVEDGRVLFGLVGV
PVSGRCYYGGAGLGAWREEADGRAQPISVRLEPEEAFTVVASKRHGSPAQERLLDGLSER
FGDLRRASIGSSLKFCLLAEGAADCYPRLTPTSQWDTAAAQGVLEGAGGEVLDLHGAPFT
YEPREDYLNGSFLALPRAAEWRSELIQLARALH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggtgccttggggcgaattggtggcgctggtgcggcgcgccggcgaggcgatc
ctgccgcactggcgcgccgacgtggcggtgcgctcgaaggccgacgaatcgccggtgact
gccgccgacctggccgcgcaccatatattggaggcgggattgcgggcgctggcgccggac
attccggtgctttccgaagaggattgcgagataccgctgagcgagcgcggccactggcgg
cgctggtggctggtggacccgctggacggcaccaaggagttcatctccggtagcgaggag
ttcaccgtcaacgtggccctggtcgaggatggccgggtgctgttcggcctggtcggcgtg
ccggtgagcggccgctgctactacggtggcgccggtctcggtgcctggcgcgaggaggcc
gatggccgcgcgcaaccgatcagtgtgcgcctggagcccgaggaggccttcaccgtggtg
gccagcaagcgccacggcagcccggcccaggagcgcctgctggatggcttgagcgagcgc
ttcggcgacctgcggcgagccagtatcggcagttcgctgaagttctgcctgctggccgag
ggcgctgccgactgctatccgcgcctgacgccaacctcgcaatgggacacggccgccgcc
cagggtgtgctggagggcgccggcggcgaggtgctcgacctgcatggcgcgccattcacc
tacgagccgcgcgaggactacctcaacggctccttcctggccctgccgcgcgctgccgag
tggcgcagcgaactgatccaactggcgcgcgcgctgcactga

DBGET integrated database retrieval system