KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_70270Help
Entry
PA14_70270        CDS       T00401                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA14_70270 (algC)
   00030 Pentose phosphate pathway
    PA14_70270 (algC)
   00051 Fructose and mannose metabolism
    PA14_70270 (algC)
   00052 Galactose metabolism
    PA14_70270 (algC)
   00500 Starch and sucrose metabolism
    PA14_70270 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PA14_70270 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PA14_70270 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PA14_70270 (algC)
Enzymes [BR:pau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PA14_70270 (algC)
    5.4.2.8  phosphomannomutase
     PA14_70270 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6264129..6266693
Genome map
AA seq 854 aa AA seqDB search
MGDLLEPEKKPRKAASERADGKDLLPGIGASLLGVAAAGALLWFGVFGGAGEAQQRQLDA
AWAEGQAGALRQALQQLAADTRAAAASPLALEALQSGDAARIEAAQRSLLAWDGVVDAHL
NAPGQATQDNDSPGPVSFAALDILHRVESGQNVAAEAYKVGQRWLLYSAAPVRGADQSLQ
GTLLLAVDLQRLLRALPPLPGDAGQVQLVQQFSGAPAQVLLQRGMPAPGKGAQALDSGNP
NWKLNYTPGSVASTQASPLLLALAALLALLGGILGAYLTRSSLLRRLHQDVLTLGQYLQE
LGGQRTAKPPVPSLPGFAPLIQALARQPRRKPEPTSAPSPAKAAPVAVAVAKAPPREEPA
LADPLFQNTDILDIDILDEDQDLLGLEQTPIMSTAKAPTLPASIFRAYDIRGVVGDTLTA
ETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQGLVDCGCQVSDVGMVPTPV
LYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQIQALRERIEKNDLASGVGS
VEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAPQLIEALGCSVIPLYCEVDGN
FPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVVTNTGTIIYPDRLLMLFAK
DVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHSLIKKKMKETGALLAGEMSGH
VFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPSDISTPEINITVTEDSKFAII
EALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEADTEEELERIKTVFR
NQLKAVDSSLPVPF
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgacctgctcgaaccggaaaagaagccgcgcaaggcagcgtccgaacgcgctgac
ggcaaggacctgctgcccggcataggcgccagcctgctgggcgtggcggccgccggcgcc
ctgctctggttcggcgtcttcggcggcgccggtgaggcacagcagcgccagttggacgcg
gcctgggccgaaggccaggccggcgccttgcgccaagccttgcagcaactcgccgccgac
acccgcgccgccgcggccagccccctcgccctcgaagccctgcaaagcggcgacgccgcc
cgcatcgaggccgcccagcgcagcctgctggcctgggacggcgtggtcgatgcccacctg
aacgcgcccggtcaggccacccaggacaacgacagccccggcccggtcagcttcgccgcc
ctggatatcctgcaccgggtggaaagtggccagaacgtcgccgccgaagcctacaaggtc
ggccagcgctggctgctgtacagcgccgcgccggtgcgcggcgccgaccagagcctgcaa
ggcacgctgctgctggcggtcgacctgcaacggctgctgcgcgccctgccgcccttgccg
ggcgatgccggccaggtgcaactggtccagcagttctccggcgcaccggcccaggtgctg
ctgcaacgcggtatgccggcgccgggcaagggtgcgcaagcgctggacagcggcaatccg
aactggaaactgaactacacgcccggcagcgtcgcctcgacccaggcctcgccgctgctg
ctggcactcgcggcgctgctggccctgctcggcggcatcctcggcgcctacctcacccgt
tcgtcgctgttgcgccgcctgcaccaggatgtcctgaccctcggtcagtatcttcaggaa
ctcggcgggcaacgcactgccaaaccccctgtgcctagcctgccgggcttcgccccgctg
atccaggcattggcccgccagccgcggcgcaagccggagccgaccagcgcgcccagccct
gccaaggcagcgccggtggcggtggcggtggcgaaagcgcctcctcgcgaggagccggca
ttggcagatccgttgttccagaacaccgacattctggatatcgacattctcgatgaagac
caggacctcctgggattggagcaaacccccatcatgagcactgcaaaagcaccgacgctg
cccgccagcatcttccgcgcctacgacatccgcggcgtggtaggcgataccctcaccgcc
gagaccgcctactggatcggtcgcgccatcggctcggaaagcctcgcccgcggcgaaccg
tgcgtcgctgtcggccgcgatggccgcctgtccggtcccgaactggtcaagcagctgatc
cagggcctggtggactgcggttgccaggtcagcgacgtgggcatggtgcctaccccggtg
ctgtactacgcggccaacgtgcttgagggcaagtccggggtgatgctgaccggcagccac
aacccgccggactacaacggcttcaagatcgtggtcgccggcgagaccctggccaacgag
cagatccaggccctgcgcgagcgcatcgagaaaaacgacctggcatccggcgtcggcagc
gtagagcaggtcgacatcctgccgcgctacttcaagcagatccgcgacgacatcgccatg
gccaagccgatgaaggtggtggtcgactgcggcaacggcgtggccggggtgatcgccccg
cagctgatcgaggccctgggctgcagcgtgatcccgctgtactgcgaggtcgacggcaac
ttcccgaaccaccatccggacccgggcaagccggagaacctgaaggacctgatcgccaag
gtcaaggccgagaacgccgacctgggcctggccttcgacggcgacggcgaccgcgtcggc
gtggtcaccaataccggtaccatcatctatccggaccgcctgctgatgctgttcgccaag
gacgtggtctcgcgcaacccgggggccgacatcatcttcgacgtcaagtgcacccgccgt
ctgatcgccctgatcagcggctacggcggccgtccggtgatgtggaagaccggccactcg
ctgatcaagaagaagatgaaggaaaccggcgccctgctggccggcgagatgagcggccac
gtgttcttcaaggagcgctggttcggcttcgacgatggcatctacagcgccgcccgcctg
ctggaaatcctcagccaggaccagcgcgacagcgagcacgtgttctcggccttcccgagc
gacatttccaccccggaaatcaacatcaccgtcaccgaggacagcaagttcgccatcatc
gaggcgctgcaacgcgacgcccaatggggcgaaggcaacatcaccaccctcgacggcgtg
cgggtcgactaccccaaaggctggggcctggtacgcgcctccaacaccactcccgtgctg
gtcctgcgcttcgaagcggacaccgaggaagagctggagcgcatcaagaccgtcttccgt
aaccaactgaaggcagtggattcctcgctgcccgtgcccttctga

DBGET integrated database retrieval system