KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_70570Help
Entry
PA14_70570        CDS       T00401                                 

Gene name
recG
Definition
ATP-dependent DNA helicase RecG
Orthology
K03655  
ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PA14_70570 (recG)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PA14_70570 (recG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6285895..6287970
Genome map
AA seq 691 aa AA seqDB search
MTELSRVPVTALKGVGAALAEKLARVGLETLQDILFHLPLRYQDRTRVTAIGALRPGADA
VVEGVVAGADVVMGRRRSLLVRLQDGSGTLSLRFYHFSQAQKDGLKRGTHLRCYGEVRPG
ASGLEIYHPEYRALNGDEPIPVEQTLTPIYPTTEGLTQQRLRQLSQQALAMLGPSSLPDW
LPAELARDYQLGPLDQAIRYLHRPPPDADIEELAEGRHWAQLRLAFEELLTHQLSLQRLR
EAVRSQAAPRLPAASRLPKRFLANLGFQPTGAQRRVGAEIAYDLAQDEPMLRLVQGDVGA
GKTVVAALAALQAIEAGYQVALMAPTEILAEQHFLNFSKWLQPLDIEVAWLAGKLKGKAR
AAALERIGDGAPMVVGTHALFQDEVKFKRLALAIIDEQHRFGVQQRLALRQKGVDGRLCP
HQLIMTATPIPRTLAMSAYADLDTSILDELPPGRTPVNTVLVADSRRIEVIERVRAACRE
GRQAYWVCTLIEESEELTCQAAETTYEELSSALGELRVGLIHGRMKPADKAVVMEAFKEG
MLQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGSAASHCVLLYHPPL
SQIGRERLGIMRETSDGFVIAEKDLELRGPGEMLGTRQTGLLQFKVADLMRDADLLPAVR
DAAQSLLAHWPQHVSPLLERWLRHGQQYGQV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctgtccagggtcccggtcaccgcgctaaagggcgtaggcgccgcactggcg
gagaagctcgctcgggtaggcctggaaaccctgcaggacatcctgttccacctgcccctg
cgctaccaggaccgtacccgcgtcaccgccatcggcgccctgcggccaggggccgacgcg
gtggtcgagggcgtggtggccggcgccgacgtggtgatggggcgccgccgcagcctgctg
gtgcgcctgcaggacggcagcggcaccctgagcctgcgcttctaccatttcagccaggcg
cagaaggacggtctcaagcgcggcacccacctgcgctgctacggcgaagtccggccgggc
gcctcgggcctggagatctaccatccggaataccgcgcgctgaacggcgacgagccgatt
ccggtggagcagaccctgacgccgatctacccgactaccgaaggactcacccagcagcgc
ctgcgccagttgagccaacaggccctggccatgctcggtcccagcagcctgcccgactgg
ctgccggcggaactggcccgcgattaccaacttggcccgctcgaccaggcgatccgctac
ctgcaccggccgccgccggatgccgacatcgaggaactggccgaaggccggcactgggcg
cagttgcgcctggccttcgaagaactgctgacccaccagttatccctgcagcgcctgcgc
gaagccgtgcgttcgcaggcagcgccgcgcttgccggcggccagccgcttgccgaaacgc
ttccttgccaacctcggcttccagccgaccggcgcgcaacgccgggtcggcgcggagatc
gcctacgacctggcccaggacgaaccgatgctgcgcctggtgcaaggcgacgtcggcgcc
ggcaagaccgtggtcgccgccctcgccgccctgcaagccatagaggccggctaccaggtg
gcgctgatggcgccgaccgagatcctcgccgagcagcatttcctcaacttcagcaagtgg
ctccagccgctggacatcgaagtcgcctggctggccggcaagctcaagggcaaggcccgc
gcggcggcactggaacgcatcggcgacggcgcgccgatggtggtcggcacccacgcgctg
ttccaggatgaagtgaaattcaagcgccttgcactggcgatcatcgacgaacagcaccgc
ttcggcgtgcagcagcgcctggccctgcgccagaagggcgtggacggcaggctctgcccg
caccagttgatcatgaccgccacgccgatcccgcggaccctggcgatgagcgcctatgcc
gacctcgacacctcgatcctcgacgagctgccgcccgggcgtaccccggtgaataccgtg
ctggtggccgacagccgccgtatcgaggtgatcgagcgagtccgcgcggcttgccgcgaa
gggcgccaggcctactgggtgtgtaccctgatcgaagagtccgaggagcttacctgccag
gccgccgagaccacctacgaagagctttcctcggcgctgggcgaactgcgtgtcggcctg
atccacgggcgcatgaagccggcggacaaggccgtggtgatggaggccttcaaggaaggc
atgttgcaactgctggtggcgaccacggtgatcgaggtcggcgtcgacgtgcccaacgcc
agcctgatgatcatcgagaaccccgagcgccttggcctggcccaactgcaccagctacgc
ggccgtgttggccggggcagcgccgccagccactgcgtgctgctctaccacccgccgctg
tcgcagatcggccgcgagcggctgggcatcatgcgcgagaccagcgacggcttcgtcatc
gccgagaaggacctggaattgcgcggccccggcgaaatgctcggcacccgccagaccggc
ctgctgcaattcaaggtcgccgacctgatgcgcgacgcagacctgctgccggcggtccgc
gatgccgcccaatccctcctggcgcactggccgcagcatgtcagcccgctgctcgaacgg
tggttgcgccacggccagcaatacggtcaagtgtga

DBGET integrated database retrieval system