KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_71570Help
Entry
PA14_71570        CDS       T00401                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA14_71570
Enzymes [BR:pau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PA14_71570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6376091..6377047
Genome map
AA seq 318 aa AA seqDB search
MILLPSIRLPETAMSTDSPINRVEQVQVDDLACWRIHTAHGEALIAQQGAQLLSYQPHEQ
PPLVWLSDEAGYRRGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDW
EIDDIAEEDGDLCVSFRLDAPDGLPGWPHPAALRMLFRFGERLTLRLTSENLGSKPLVLS
QALHTYFAVSDSREIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLI
KDPRWERSIHLHALDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMVVAP
GRSESFGVQIWSEPLKRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgatactgctgccatccattcgcctcccggagaccgccatgagcaccgatagcccgatc
aaccgcgtcgaacaggtacaggtcgacgacctggcctgctggcgcatccacaccgcccat
ggcgaggcgctgatcgcccagcagggcgcgcaactgctcagctaccagccccacgaacag
ccgccgctggtctggctcagcgacgaggccggctaccggcgcgggcagtcggtacgcggc
ggggtgccggtgtgctggccgtggttcggtccgctggagcgcaacccgcaggaagtccgc
ggccaggtggaagatggcctgaaggcgcccgcccacgggctggttcgggcggtcgactgg
gaaatcgacgacatcgccgaggaggacggcgacctctgcgtcagcttccgcctcgacgcc
cccgatggcctccccggctggccgcacccggcggcgctgcgcatgctgttccgcttcggc
gagcgcctgaccctgcgactcaccagcgagaacctcggcagcaagccgctggtgctcagc
caggcactgcacacctacttcgcggtcagcgacagccgcgagatcgccatcgagggcctg
gaaggcgcgcgctacatcgagaccctggagaactgggaagaacgcactcagcacggcgcg
gtacgggtcaagggcgaactggaccgcatctacctcggtctcgaacgcgacctgctgatc
aaggacccgcgctgggaacgcagcatccacctgcacgccctcgactcgcgttcggcggtg
gtctggaacccctgggtggacaagtcccggcgtctttcgcagttcgccgacgacgcctgg
cagcagatgctctgcatcgagacggggcgggtctgggacgacctcatggtggtcgccccc
gggcgcagcgaaagctttggcgtgcagatctggagcgagccgctgaaacgaccctga

DBGET integrated database retrieval system