KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_00315Help
Entry
TIA2EST22_00315   CDS       T01654                                 

Definition
glycosyl hydrolase family 20, catalytic domain protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pav00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pav00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(67552..69090)
Genome map
AA seq 512 aa AA seqDB search
MPTNDTLIRGLCPQPRQVQLTEGQFPLPSVLTWTGPDEVINAVTILTERLAPALDVVRAT
SHTDDASLTVIVDPALEAEGYRIDIDAQVRITVGSPSGARWAVQTLLQLLTPWVYGPGPL
ALKHLCLPKGVIVDAPHHSWRGAHLDVSRHFMPTSFIMNFLDVLAVHKLNRLHLHLTDDQ
GWRLPVPGWPRLTTVGAWRPGTVRGHQPPPDDNGCDDVAEHDHIPHGGAYTVDQLRAIDE
RAQLLGITVVPEVDLPGHTESVVAAYPELGCGAPISHPRTAFGVSEHHINLTDAALGFCR
DVLDAVMEIFPNSPIHIGGDECPGKEWFGHKPTRTRLAELGITTPHQAQAWFERQICGHV
VAAGRQVIAWDEVLEAGAPEEVTVMVWRDADDIARAAAAGHDVIAAPARHTYLDHGMETG
PQAPVTIDAPMTMNDVAGLHDVLAAVNSPHLLGGQFQLWTEYLCTPAQVEDAAFPRGTSI
AEQLWTGNPARPLSELEAQTRRLTAMGVNWHR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaacgacaccctcatccggggcttgtgcccccagccccgccaggtacaactc
accgaaggacaattccccctgccgtcggtgctcacctggactggccccgacgaggtcatc
aacgccgttacgatcctcaccgagcgactggctccagcactcgacgtcgtgcgagcaaca
tcacacaccgacgatgcctccctcaccgtcatagtggatcccgctttagaagcggagggc
tatcgcattgacatcgacgcgcaggtccgcatcactgtcggcagtccatctggagcgcgt
tgggcagtgcaaaccctgctccagctgctcaccccgtgggtttacgggcccggaccgcta
gcgctgaagcacctatgccttccgaaaggcgtcatcgtcgatgcgccacaccacagttgg
cgcggggcccatctagacgtttcgcggcatttcatgcccacctcgttcatcatgaacttt
ttggacgtgctggccgtacacaagctcaatcggctgcacctacatctcactgacgatcag
gggtggcgtctgccggtaccgggctggccgcggctgaccacggtgggcgcgtggcgtcca
ggaacggtacgagggcaccaaccgccacccgacgacaacggctgtgacgacgtcgctgag
cacgaccacataccccacggtggtgcctacaccgtcgaccagctgcgcgccatcgacgag
cgagctcagctgttgggcatcacggtcgtcccggaagtcgatcttccgggacacaccgag
tcggtggtggccgcctaccccgagttgggctgtggagcaccgatcagccatccgcgcacc
gccttcggggtgtcggagcaccacatcaacctcaccgatgctgcgctgggtttttgccgc
gacgtcctggatgccgtgatggagatcttcccgaactcgccgatccacatcggcggcgac
gagtgccccggcaaggagtggtttggacataagcccacccgcacccggctagccgagctg
ggcatcacgaccccacaccaggctcaggcgtggttcgagcgccagatctgtggccacgtc
gtcgctgctgggcgtcaggtcatcgcctgggacgaggtgttggaagccggtgcgcccgag
gaggtcaccgtgatggtgtggcgggatgccgacgacatcgcccgcgctgctgccgcaggt
cacgatgtcattgccgcacccgcccggcatacctacttagatcacggcatggagacgggc
ccgcaggcaccggtgacaatcgacgccccgatgactatgaacgatgtcgccgggctgcac
gacgtgctggccgcggtgaactcaccccacctgctgggtggacagttccagttgtggacc
gaatatctgtgcacccctgctcaggtcgaggatgccgccttcccgcgcggcacgtcgatc
gccgaacagttgtggactggcaacccggctcgaccgctgtcggaattagaggcccaaact
cgccgtctcaccgcgatgggggtcaattggcaccgataa

DBGET integrated database retrieval system