KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_00440Help
Entry
TIA2EST22_00440   CDS       T01654                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST22_00440
   00030 Pentose phosphate pathway
    TIA2EST22_00440
   00051 Fructose and mannose metabolism
    TIA2EST22_00440
   00052 Galactose metabolism
    TIA2EST22_00440
  Energy metabolism
   00680 Methane metabolism
    TIA2EST22_00440
Enzymes [BR:pav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIA2EST22_00440
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TIA2EST22_00440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
102606..103838
Genome map
AA seq 410 aa AA seqDB search
MAVVTVTHMIATVDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPGLNAAIRG
FGKAAIRQHDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRDKVNHMIID
GEERDMVPTIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTIDNDIVGTDD
SFGFSTALEIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGGADVILLPEVP
YKLDSIVQAVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASKTSETKAAAKKA
KKDLEHSMRDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLLATRLGTVGAKLV
DDGEFGIMVAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTGLGD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgtcacagtgacgcacatgattgccacagtggaccgcagtgttgtcggcgcc
atccatggaaggatgggtaccacccgacacagatcaggagtcgtcatgtccaaaaagaag
aaggtcggcatcctcaccgcaggcggtgattgccccgggctcaacgccgctatccgcgga
tttggcaaggctgccatccgccagcacgacatggagctcatcggtattcaggacggcttt
cttggattggcagggaaccgcaccatctcccttgacccgcgtgccctctcaggcatcttg
acggtcggcgggaccatcctgggaactagccgtgacaaggtcaatcacatgattatcgac
ggcgaggaacgggatatggtccccaccatcgtcgagaattacgagaagctgggacttgac
gctttggtgactttgggtggcggtggcaccgccaagaacgcgtacaagctcgctaaggcc
gggctgaacgtcctgcatctgcccaagacgattgacaacgacatcgtcggaaccgacgac
tccttcgggttctcgacagcactggagattgccacggaggccatcgaccggctgcactcc
accgcccattcccaccaccgcatcatcctcgctgagatcatgggccaccgtgccggctgg
ctggccctcggctcgggcatcgctggtggcgctgacgtcatcctgctgcccgaggtgccc
tacaagctggactccatcgtccaggcggtggaaaaccggcaaaagcaggggttgaatttc
tcggtcatcgcggtggctgagggagctcgcgatgaggctgattcggccgcgatggctgga
gctcaggccctcgttgacgcttccaagacctccgagacaaaggcggctgccaagaaggcc
aagaaggaccttgagcattccatgcgtgacaacaccctcaaattggctactcagcttgag
gaggccaccgggctggaatcgcgagtctcgatcctcggctatgtgcagcgcggtggtatc
ccgtgcgcccacgaccgtctgctcgcgacccggctgggaaccgtgggtgccaagctcgtt
gacgacggcgagttcggcatcatggtcgccgctcagggcggagacgccacgaccgttccg
ttgaaagacgtcgctggcaaggttaaatacgtacctgccgaccacccatgggttaaggcg
gcccgacaggtcggaaccggtctaggcgactga

DBGET integrated database retrieval system