KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_01385Help
Entry
TIA2EST22_01385   CDS       T01654                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIA2EST22_01385
Enzymes [BR:pav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TIA2EST22_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320578..321423
Genome map
AA seq 281 aa AA seqDB search
MINVGSATNSHPARTLVMGVVNVTPNSFSDGGMWADPEVAIRHARDLVVEGADIIDVGGE
STRPGTERTPEHEELRRVLPVVKALVADGVAVSVDTMRASVAKAVVEAGATIVNDVSGGK
AEPEILDVVADAGVDYVLMHWRGQSATMQNLVDYDDVVADVISETSQQVDAAIAAGIDRR
RIIVDPGIGFSKTSEHNWQLMNAVDAFQEGFADLRVLWGVSRKRFLGELLAQNGEDRPAL
ERDASTMALSTYFALHHAWCVRTHEVRANRDAVETVARLLA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgtcggctcggctaccaactcgcatcccgcccgcaccctcgtcatgggggtc
gtcaacgtcactcctaactcgttctctgacggaggcatgtgggccgatcctgaggtggcc
atccgccacgctcgcgacctcgttgtcgaaggagctgacatcatcgacgtcggtggtgaa
tcgacccgtccgggcaccgaacgcacccccgagcacgaagaattgcgccgcgtcctgccc
gtcgtcaaagctttggtggccgacggggtagccgtctccgtcgacactatgcgcgcctca
gtggccaaggctgttgtcgaggcaggagccaccatcgtcaacgacgtctctgggggcaag
gctgaaccggaaatccttgatgtcgttgccgacgctggcgtcgattacgttctcatgcac
tggcgcggtcaatccgccactatgcagaaccttgtcgactatgacgacgtggtagccgac
gtcatttctgagacctcccagcaggtcgacgcagctattgccgctggaatcgaccgtagg
cgcatcatcgtcgacccgggcattggtttctccaagacttccgagcacaactggcagctc
atgaacgccgttgacgccttccaagaaggatttgccgaccttcgtgtcctgtggggagtt
agtcgcaagcgcttccttggtgaacttctcgcccagaacggggaggaccgtccggccctc
gaacgcgatgcgagcaccatggccctgtcgacttatttcgcccttcatcacgcctggtgt
gtgcgcacccacgaagttcgggccaaccgcgacgccgtggagaccgttgcccgccttctc
gcctga

DBGET integrated database retrieval system