KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_01395Help
Entry
TIA2EST22_01395   CDS       T01654                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pav00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321843..322400
Genome map
AA seq 185 aa AA seqDB search
MKTVFSLGSNMGDPFAHLRDAVRLIAETPGIHDVVVSPVYVTAPIGGVEQDDFLNLIVVA
TSDLPPSVLLERAHVIEAAHGRDHTIPNGPRTLDVDLIRVGDETVTTDELTLPHPRAHKR
AFVLVPWRDADPEAELPGYGRIADLVASFDADELADAVKPYSRQIDVAGVTVAGEWDERH
DEEDV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgtattcagcctgggttccaatatgggagacccttttgcccatctgcgagac
gccgtccgcctgatcgccgaaactcccggtattcacgacgtcgtcgtttcgcccgtctat
gtcaccgctccgatcgggggagtggagcaggatgacttcctcaacctcatcgtcgttgcg
actagcgaccttcctccgtcagtcctgttggagcgcgcccatgtcatcgaggcagcccac
gggcgcgatcacaccatcccgaatggtcctcgcaccctcgacgttgatctcattcgcgtt
ggcgacgagaccgtcaccaccgacgagttgacccttccacacccccgtgcacataagcgc
gccttcgttctggtgccgtggcgcgacgccgaccctgaggctgaattgcccgggtacggt
cggatcgccgatctggtcgcctccttcgatgctgacgagctggctgacgccgttaagcct
tattcgcgtcagattgacgtagctggggtcaccgttgcaggagaatgggacgagaggcac
gacgaggaggatgtatga

DBGET integrated database retrieval system