KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_01525Help
Entry
TIA2EST22_01525   CDS       T01654                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIA2EST22_01525
Enzymes [BR:pav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TIA2EST22_01525
Exosome [BR:pav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TIA2EST22_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(346806..347852)
Genome map
AA seq 348 aa AA seqDB search
MNPYLPDASDPRMAGVKPLPEGLRPVSRPRRLRTTPAMRRMVAETRVAPAQLMLPAFVKE
GIDSPVEITSLPGQFQHSTESIKELATQAAEAGIGGIDLFGIPEHKDEIGSQAWDLKGIL
NAGISAVREAVGDDLVICADTCLDEFTDHGHCGALTPDGRVDNDSTVPLYAAMAVSQARA
GAHMVSPSGMMDGQIAVIRDALDREGFTDVSIMAYSAKYASAFFGPFRDAVNCSLKGDRK
TYQQDPPNRREGLRETLLDLAEGADLVMVKPASHYLDVLSDVAEVSQVPVAAYQVSGEYA
MLEAAAANGWIDRRRCIGESLTSIVRAGADLVLTYWAIEAAQMFREDL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtacctgcctgatgccagtgatccccgcatggctggggtcaagccattgccc
gaggggctgcgtcctgtttctcgtccgcgtcgactacgcaccactcctgcgatgcgccgg
atggtcgccgaaacccgcgtcgcccccgcccagttaatgctgccggcgttcgtcaaagag
gggatcgattcccccgtcgagatcaccagcctgcccggccaattccagcactccaccgag
tcgatcaaggagctcgccacccaagctgccgaggccggtattggtggtattgacctgttt
ggtatcccggagcacaaagacgagatcggttctcaggcctgggacctgaaaggcatcctc
aacgccggcatctccgcggtgcgcgaggccgtcggcgacgatctggtgatctgtgccgac
acctgtctagacgagttcaccgatcatggacactgcggagctctgacccctgatggtcgc
gtcgataatgactccactgtgccgctatatgccgcgatggcggtctcccaagcgcgcgcc
ggagcccacatggtctccccgtcggggatgatggacggtcagatcgctgtcattcgcgat
gctctggatcgcgagggattcaccgatgtgtccatcatggcctattcagctaagtacgct
tcagccttctttggccccttccgcgacgccgtcaactgttcccttaagggtgatcgcaag
acttaccagcaggatccaccgaaccgccgggaaggcctgcgcgaaacccttctcgacctc
gccgagggagccgacctggtcatggtgaagcccgcctcccactacctcgacgtgttgtcc
gatgtcgccgaggtgtcgcaggtaccggttgccgcttaccaggtctctggagaatacgcc
atgctcgaggccgctgccgcaaacggttggatcgatcgccgacgttgcatcggagagtcc
ctgacctcgatcgtgcgtgccggtgccgatcttgtcttgacctactgggcaatcgaggcg
gcgcagatgtttcgcgaggacctctga

DBGET integrated database retrieval system