KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_01540Help
Entry
TIA2EST22_01540   CDS       T01654                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pav00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(349655..351085)
Genome map
AA seq 476 aa AA seqDB search
MNISDPQHVDAVVIGGGMAGLVAAWQFTQEGLHPVLVESRGYTGGLIARSTLAGISYDIG
AEGWAVRLPDTAELATELGLTVEKPTIAPSWVYFDDACFAMPDNAILGIPANLSDPAVII
ALGAEEAARAAELDRAPMPEDLPRDLGTLVASRMGSEVLRRLVTPIAGGIHAADPHLLSV
DVVSPGLRAATQATGSLAAGVALCRSRMPAGPAVASVAGGMFIMPAELRRQAEQAGATTM
TRVGARGLTRHGDQWLVETAGTSRNPDPSLPPVTDGEIRSFLTPRVVVACSAGPATKLLS
NVIDTVGPELAPGAPIGHVNLALQAPALDSSPRGNGMLVAPGTTTVTAKALTHMSAKWPS
LRESCPEGLHLLRVSYGRSGEANVALSVDQALTDASVLLGVDLSAEQVVDSQIIHWTGSL
APTTPQARAWRDGLHRQLEVLNQSGQGRIGLVGSWASGSGIAALVPQARRTVRQLV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttctgatccgcagcacgtcgacgccgtcgtcattggcgggggcatggctggc
ctcgtggccgcctggcagttcacccaggaaggtctgcacccggtacttgtcgaatcccgc
gggtacaccggcgggctgattgccaggtcgacgctggccggaatcagctacgacatcggg
gccgaggggtgggcggtccgtctaccagacaccgctgaactggccaccgagttgggattg
acggttgagaagccgaccatcgccccgtcttgggtgtacttcgatgacgcctgcttcgcg
atgcccgataatgccattcttggcatcccggcgaacttgtcggacccagccgtcatcatc
gccctgggagcggaagaggctgcccgcgccgccgaacttgatcgcgcacccatgcctgag
gatctccctcgcgacctgggtacgctcgttgcctcccggatggggtcagaggtattgcgg
cgtctcgtcaccccgatcgccgggggaatccacgccgccgacccacatctactgtcagtc
gacgtcgtctcccccggtctgagggccgccacccaggccaccggatcgctagcagcggga
gttgcgctgtgccgctcacggatgccagcggggcctgcagtcgcgtcggtagccggtggc
atgttcatcatgccggccgagctgcgtcgtcaggcagaacaggccggcgcgacgaccatg
acccgagtaggagctcgcgggctaacccgccacggagatcagtggctagtggagaccgct
ggtacctcccgcaatccggatccatctttgccccccgtcaccgacggcgagattcgttcc
ttcctgacccctcgggtcgtcgtggcctgttcggctggacctgccacaaaactgctcagc
aatgtcatcgacaccgttgggcccgagttggcaccgggcgcgccgatcggccacgtcaat
ctcgccttgcaggcacccgcgctggactcgagcccacgcggaaacggcatgctggtggcc
cccggaacgaccaccgttactgccaaggcacttactcacatgtcggcgaagtggcccagc
ttgagagaatcgtgtcccgaaggtctccacttgctacgggtttcctatggtcgatctggt
gaagcgaatgtcgctttgagcgtcgatcaggctctaacggacgcttccgtcctactcggc
gtggacctctcggcggagcaggtcgtagactcccagatcattcactggacaggttccctc
gcaccgacgactccacaggcccgagcatggcgcgatggtctgcaccgccagctagaggta
ttgaaccagtctggacagggacggatcggcttagtggggtcgtgggcatcgggttcgggc
attgccgctctggtgccgcaggcccgccgaactgtccgtcaacttgtctga

DBGET integrated database retrieval system