KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_02405Help
Entry
TIA2EST22_02405   CDS       T01654                                 

Definition
(GenBank) phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00260  Glycine, serine and threonine metabolism
pav00680  Methane metabolism
pav00750  Vitamin B6 metabolism
pav01100  Metabolic pathways
pav01120  Microbial metabolism in diverse environments
pav01130  Biosynthesis of antibiotics
pav01200  Carbon metabolism
pav01230  Biosynthesis of amino acids
Module
pav_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    TIA2EST22_02405
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIA2EST22_02405
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TIA2EST22_02405
Enzymes [BR:pav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     TIA2EST22_02405
Amino acid related enzymes [BR:pav01007]
 Aminotransferase (transaminase)
  Class V
   TIA2EST22_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEW80811
Position
complement(523847..524965)
Genome map
AA seq 372 aa AA seqDB search
MAQPMIPRDLLPSDPRFGCGPSRIRREVVASLSEPGSVMGTSHRQPPVRHVVAAIREELT
ELYNLPTDYEVALGNGGATLFWDMATVSLVEKRAATGVYGEFTRKFSSALQRAPFLADPA
VFQAEPGKLALPKAVSDVDTYAWAHNETSTGVVAPVRRPNDIDDNSLVLVDATSAAGGVA
ADMSTIDAYYFSPQKNLSSDGGLWLAILSPAAIERSNRVTSSARWVPQMLDLSLAVTNSR
ADQTLNTPALATLVMLEAQCRWLLDQGGMAWAASRTASTSGILYRWAEDNPLTTPFVADP
ALRSPVVVTIDIDESVDAARLCARARDNGILDIEPYRKLGRNQIRIATFSSIEPSDVEAL
TACLDWLLENRD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctcagccaatgattcctcgtgaccttttgccctccgacccccgattcgggtgtggc
ccatctcggatccgacgggaggtggtggccagtctgtccgaaccgggatccgtgatgggt
acctcccatcgccagccaccggtccgtcacgtagtcgcggcaatccgtgaagagttgact
gaactgtataacctgccgaccgattatgaggtggcactcggcaacggtggagccaccctt
ttctgggatatggcaaccgtctccctcgtggaaaaacgagccgccaccggcgtctacggg
gaattcacgcgaaagttctcctcagctctgcagcgtgcccccttccttgctgaccccgca
gtatttcaagccgaacccggcaagctcgccctcccgaaggccgtcagcgacgttgacacc
tacgcatgggcccataacgagacctccaccggcgtcgttgccccagtccgacgacctaac
gacattgacgacaactccctcgttctcgttgacgccacctcggccgccggcggcgtcgcg
gcggatatgtcaaccattgacgcctactacttttcaccgcagaaaaatctgtcttcagat
ggtggattgtggcttgcgatcctgtcacctgcagcgatcgaacgctcgaacagagtgacc
tcctcggcccgctgggtaccccagatgctcgatctgagtctcgccgtgacgaactcgcga
gctgatcagaccctgaataccccggctctggccaccctcgtcatgctcgaggcgcaatgc
cgttggctactcgatcagggcggtatggcgtgggctgcatcacgcacagcgtcaacgtca
ggaatcctctaccgctgggccgaggacaaccccctaacgaccccgttcgtcgctgacccg
gcgctgcgcagcccagttgtcgtgacgatcgacatcgacgagtccgtcgacgccgcacga
ctgtgtgcccgcgcccgcgacaacggcatcctcgacatcgagccttaccgcaagctaggg
cgcaatcagatccgaatcgcaaccttcagctcaattgagccgagcgacgtcgaggctctg
acggcatgcctggactggctactagagaaccgcgactaa

DBGET integrated database retrieval system