KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_02405Help
Entry
TIA2EST22_02405   CDS       T01654                                 

Definition
phosphoserine aminotransferase
Orthology
K00831  
phosphoserine aminotransferase [EC:2.6.1.52]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Class
Metabolism; Overview; Carbon metabolism [PATH:pav01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pav01230]
Metabolism; Energy metabolism; Methane metabolism [PATH:pav00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pav00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pav00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(523847..524965)
Genome map
AA seq 372 aa AA seqDB search
MAQPMIPRDLLPSDPRFGCGPSRIRREVVASLSEPGSVMGTSHRQPPVRHVVAAIREELT
ELYNLPTDYEVALGNGGATLFWDMATVSLVEKRAATGVYGEFTRKFSSALQRAPFLADPA
VFQAEPGKLALPKAVSDVDTYAWAHNETSTGVVAPVRRPNDIDDNSLVLVDATSAAGGVA
ADMSTIDAYYFSPQKNLSSDGGLWLAILSPAAIERSNRVTSSARWVPQMLDLSLAVTNSR
ADQTLNTPALATLVMLEAQCRWLLDQGGMAWAASRTASTSGILYRWAEDNPLTTPFVADP
ALRSPVVVTIDIDESVDAARLCARARDNGILDIEPYRKLGRNQIRIATFSSIEPSDVEAL
TACLDWLLENRD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctcagccaatgattcctcgtgaccttttgccctccgacccccgattcgggtgtggc
ccatctcggatccgacgggaggtggtggccagtctgtccgaaccgggatccgtgatgggt
acctcccatcgccagccaccggtccgtcacgtagtcgcggcaatccgtgaagagttgact
gaactgtataacctgccgaccgattatgaggtggcactcggcaacggtggagccaccctt
ttctgggatatggcaaccgtctccctcgtggaaaaacgagccgccaccggcgtctacggg
gaattcacgcgaaagttctcctcagctctgcagcgtgcccccttccttgctgaccccgca
gtatttcaagccgaacccggcaagctcgccctcccgaaggccgtcagcgacgttgacacc
tacgcatgggcccataacgagacctccaccggcgtcgttgccccagtccgacgacctaac
gacattgacgacaactccctcgttctcgttgacgccacctcggccgccggcggcgtcgcg
gcggatatgtcaaccattgacgcctactacttttcaccgcagaaaaatctgtcttcagat
ggtggattgtggcttgcgatcctgtcacctgcagcgatcgaacgctcgaacagagtgacc
tcctcggcccgctgggtaccccagatgctcgatctgagtctcgccgtgacgaactcgcga
gctgatcagaccctgaataccccggctctggccaccctcgtcatgctcgaggcgcaatgc
cgttggctactcgatcagggcggtatggcgtgggctgcatcacgcacagcgtcaacgtca
ggaatcctctaccgctgggccgaggacaaccccctaacgaccccgttcgtcgctgacccg
gcgctgcgcagcccagttgtcgtgacgatcgacatcgacgagtccgtcgacgccgcacga
ctgtgtgcccgcgcccgcgacaacggcatcctcgacatcgagccttaccgcaagctaggg
cgcaatcagatccgaatcgcaaccttcagctcaattgagccgagcgacgtcgaggctctg
acggcatgcctggactggctactagagaaccgcgactaa

DBGET integrated database retrieval system