KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_02635Help
Entry
TIA2EST22_02635   CDS       T01654                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pav00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571880..572851
Genome map
AA seq 323 aa AA seqDB search
MVMMDDPFDLLRPMTVTVRVSAKVNLALGVGGLAPDGFHPLATVFEAICIYDEVAVTRRD
DSRITLTVSGEDADQVPTDETNLAWRAVELVREEFASEWGKRGHGADIHIDKSIPVAGGM
AGGSADAAGALMAAAALCRLPYSPEELQPLAAQLGSDVPFCLTGGVALGRGRGDRLAPVI
CRGRHRWVFATSNQGLSTPAVYRRFDELGGTPGGETVPNDLISALTRGDLDAVAASLSND
LQAAAIDLRPELEEVLTVGREVGALTALVSGSGPTCAFLVRDTAGAKKVSAAVSNLPQVH
RTRTARGPAAGAQLLPGPVGSFA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgatggacgatccgtttgacttgctccggccgatgaccgtgacggtgcgggtc
agcgccaaggtcaatctggcgctcggggttggtggccttgcgcccgacggctttcacccg
ttggcgactgtcttcgaagctatctgcatttacgatgaggtggcggtgactcgtcgcgac
gattcgcgcatcaccctcaccgtctcaggagaggacgccgatcaggtccctaccgacgag
acgaatttggcctggcgagctgtagaactcgttcgcgaggaattcgcttcagaatggggg
aaacgtggccatggcgccgacattcacatcgataaatcgatcccggtcgctggtgggatg
gctggaggatcagctgacgcagcgggcgccctcatggcagcggccgcgctgtgtcggctc
ccttactcccccgaggaattacaaccgttggctgctcagcttggctccgacgtgcccttc
tgtctcaccggtggagtggcgttagggcgaggtcgaggagaccgtcttgcgccagtgatc
tgccgaggacgtcatcgctgggtgttcgcgacatcgaatcagggactgtccaccccggct
gtctaccgacgtttcgacgagttgggcggcacccctgggggagaaacggtgcccaatgac
ctcatctcggccttgacccgcggcgatcttgatgctgtcgctgccagtttgagcaatgac
ttacaggccgctgccatcgaccttcggcccgaactcgaagaggtgttgacggttgggcga
gaggtgggtgcgttgaccgctttggtttctggatcggggccgacctgcgccttcctcgtc
cgggacaccgctggcgccaaaaaggtgagcgctgctgtgtccaatctgcctcaggttcat
cgcacccgaactgcccgcggtccagctgcgggagcgcagctcctgcctggcccggtgggg
agctttgcatga

DBGET integrated database retrieval system