KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_03070Help
Entry
TIA2EST22_03070   CDS       T01654                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TIA2EST22_03070
Enzymes [BR:pav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     TIA2EST22_03070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
662861..663436
Genome map
AA seq 191 aa AA seqDB search
MGVCADLTVTASWDCIAEILDLTPDIPHARGFNATERSGAVTVAAAMAAYTQLGILAFAI
YGHDVQNADDALTDDVSARILSFGRAALAVGLMRVRSYLAMGTVSMGIAGCHVPEQALQD
YLGMRSQYIDMVELGRRITAGIYDHVEWKWAMAWVSASVRTEIRLTSSTAMLTSVNSWSI
RSRWCWLPETS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctgtgcggatctcaccgtcaccgcctcgtgggactgcatcgccgaaatcctc
gacctgactccggacattccgcacgcgagggggttcaacgccactgaacgttctggagcc
gtcaccgtggctgcggccatggcggcctacacacagctgggtattctggccttcgccatc
tacggtcatgatgttcagaatgccgacgacgccctcactgacgacgtctcggcccggatt
ctcagcttcggacgagccgccctggcagtcgggctcatgagagtccggagctacttggcg
atgggcaccgtgtcgatgggcattgccggatgtcatgtccctgagcaggcccttcaggat
tacttgggcatgcgcagccagtacatcgacatggtggaactcggccgcaggatcaccgcg
ggtatctatgaccacgttgagtggaagtgggcgatggcatgggtctcagcatcggtgagg
accgaaatccggctgacaagcagcacagcgatgctgacaagcgtgaacagctggagtatt
cggtcaagatggtgctggttgcccgagacctcatga

DBGET integrated database retrieval system