KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_03660Help
Entry
TIA2EST22_03660   CDS       T01654                                 

Definition
Putative sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:pav01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pav00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pav00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pav00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pav00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pav00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785223..786293
Genome map
AA seq 356 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDESGQIVRRIQRLTPSRSPEAVEDAIVESVRELARNLPICAV
GIGAAGWIDTEQALVRFSPHLAWRNEPLRDRLSERITVPVLVDNDANAAAWAEFRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDARALLAEGAPGAQDLLGYVADRNPGNLIGPDVTRAAVDGDRLAIELIADIGIW
LGRGMANLAAALDPDLFVIGGGVSAAGDLLLEPARTVYARTLTGRGFRPMADIQKAHFGN
DAGLIGAADLARHSINEPPGMARGFWPRRRTAVRKPRRTLRQSLSETLAGPVVRDK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttagcgttggcatagatattggcggcacgaaggttgccgctggtgtcgtagatgaa
agtggccagattgttcggcgtattcagcgcctgacaccctcgcgcagccccgaggctgtt
gaggacgctatcgttgagtcggtccgtgaattggctcgtaacctccctatctgtgctgta
ggcatcggggcagccggctggatagacactgaacaggcgctcgtgcggttttccccgcat
ttagcatggcgtaatgagccgctgcgcgatcgtctgtctgagcgcatcactgtgcctgtt
ctcgtcgataatgacgccaatgcggccgcgtgggctgagttccggttcggagccggacaa
ggatcacgggtcatggtgtgcctgacgttgggaacgggtatcgggggtgcactcgttatc
aatgggcggatgttccgcggccgatacggcatggccggagaattcggacatatgacggtg
gttcccgatggccactggtgcccatgtggcaaccgtggttgctgggagcaatacgcctcc
ggaaattccctcgtgagggatgctcgagcgttgcttgccgagggagctcccggtgctcag
gatctgttgggttatgtagctgaccgcaatccgggcaacctcattggtcctgatgtcaca
cgcgcagcggtcgatggcgatcgtcttgccattgagctcattgcagacattggcatctgg
ctgggccgtggaatggcgaacttggcagcagccttagatccagatctctttgtcattggt
gggggagtgagcgccgccggagacctcttgcttgaacctgcgcgcactgtatatgcccgc
acgctgacgggccgggggttccgcccgatggccgatattcagaaggcacatttcggtaac
gatgctgggcttatcggcgccgcagacttggctcgccactccatcaacgaaccgccgggc
atggctcgcgggttctggccacgtcgtcgtactgctgtccgcaagccacgccgtactttg
cgtcagagcctgagtgaaactctcgccggtccggttgttcgggacaagtga

DBGET integrated database retrieval system