KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_03840Help
Entry
TIA2EST22_03840   CDS       T01654                                 

Definition
UDP-N-acetylmuramate--L-alanine ligase
Orthology
K01924  
UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:pav00471]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pav00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824443..825858
Genome map
AA seq 471 aa AA seqDB search
MSLREPVELLDPSAVGPVYFIAIGGAGMSGVARIYHDLGVEVRGSDQVDSANLRDLASLG
VQTWVGHDPSHLAGARTVVVSSAIRPDNPELVEAHRLGLRIWHRSAALAALMLGREGVSI
AGTHGKTTTTGMVATMLDCAGADPSYVIGSPLAATGMSSHLGGGEAFVVEADESDGSFLQ
YPSQIVVVTNVEADHLDNWGTPQAYFDGFVSMATRPEVRYVVTNADDPGAAELACRLEST
GTVRVVTYGESEQAEVRLVDLDLNGTTASATLVHGPTQGRLELQVPGRYNLSNAAAAYCV
GSLLGISHQDLLTGIASFTGTLRRFQLVGRVADVSVFDDYAHHPTELRATLGAARRVVTG
QGRVIACFQPHLFSRTRDFAGEFGSALTLADRVIVSDIYPAREDPIPGVTGELVHDAVIA
AGGDSRYVPDKQDLPEALAEEVRPGDLVITLGAGDVTLVGPVLVGLLEGKA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcgggaacctgtcgagctacttgatcccagcgccgtagggccggtctacttc
atcgccatcggcggagccggaatgagcggtgtggcacggatttaccacgacttgggagtt
gaggtgcgcggctccgaccaggtcgactcggctaatttgcgtgaccttgcaagtctcggc
gttcagacctgggtaggtcatgatccgtcccacctggcgggggctcgtaccgtggtcgtc
tcctcggctattcgtcctgacaaccccgagctggtcgaggcacaccggctgggtttgcgg
atctggcatcgctcggccgctttggcggcactcatgctcggccgggaaggcgtctcaatc
gctggtacgcacggcaagacaacgacaaccggcatggttgccaccatgctcgattgtgcc
ggagctgacccgtcctatgtcattggctctccactggctgccacgggcatgtcctcccat
cttggtgggggagaagcattcgtggtggaggctgatgaatccgatgggtctttcctgcag
tacccaagccagatcgtcgtcgtcaccaatgtggaagccgatcacctagacaattggggt
accccgcaggcgtacttcgacggcttcgtgtcgatggcaacccgtcccgaggtgcgctac
gtcgtgactaatgccgacgatccgggggcagccgaattggcctgccgactggaaagcacc
ggcacagtgcgagtcgttacttacggagaatctgagcaagctgaggtcaggctcgttgac
cttgacttaaatgggacgacggcttcggcgactctcgttcatggccctacccagggacgc
ctggagctccaggtgcctggtcgctacaacctctctaatgcggcagccgcctactgcgtc
ggttccctgctgggaattagtcaccaggatctgttgaccgggatcgcatccttcacgggg
acgttgcgacgcttccaactggtgggtcgggttgctgacgtctcagtctttgacgattac
gcccatcacccgaccgaattgcgcgccacccttggcgcggcacgtcgtgtcgtgacgggg
caggggagggtcatcgcctgcttccagcctcatctgttttcccgtaccagagatttcgcc
ggggagttcggatcggcgcttacccttgcagaccgggtcatcgtttccgacatatatccg
gcccgtgaggatccgattcccggtgtgaccggcgagttggtgcacgacgccgttatcgcc
gcaggcggggattcccggtatgtgcccgataagcaggaccttccggaggccctcgctgaa
gaggtacgtcctggggacctcgtcatcacccttggcgcaggagatgtcactttagttggc
ccggttctggtgggcctactggagggcaaggcttga

DBGET integrated database retrieval system