KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_04075Help
Entry
TIA2EST22_04075   CDS       T01654                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST22_04075
   01230 Biosynthesis of amino acids
    TIA2EST22_04075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST22_04075
  Energy metabolism
   00680 Methane metabolism
    TIA2EST22_04075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIA2EST22_04075
Enzymes [BR:pav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TIA2EST22_04075
Exosome [BR:pav04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TIA2EST22_04075
  Exosomal proteins of melanoma cells
   TIA2EST22_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(879127..879873)
Genome map
AA seq 248 aa AA seqDB search
MHLLLIRHGQSENNAFAAQSVETYQQGRKPDPELTELGRRQAQALGKWIGSVSPRPTKLY
ASPMMRTIQTADPVAEALDLPIIINDLIFERPGPVQIVDGVETGHPGSPRSALSAITDRA
VFPESITEEGWREARIETAAEAADRAGRIAKWIRDTHNDDECIAIVAHGAIGSMMLLHLI
APQLAAGLRNHSIGSEPHWIGLQNTATSMIELHPDGYEVHWINRVDHLIEAGMVHGAVAA
STGNPGTR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcttctcctcatccgccacggccagtccgagaacaatgccttcgctgcgcagtct
gtcgagacttaccagcagggtcgcaagcctgacccggagctcaccgagcttggacgacgt
caagctcaggccctagggaagtggatcggatcggtctctcctcggccaacgaagctgtat
gcctcccccatgatgcgtaccatccagacggctgacccggtcgctgaggcccttgatctt
cctatcatcatcaatgacctcatcttcgagcgtccaggtccagttcagatcgttgacggc
gtcgaaaccggtcatccaggatcgccgcgatcagctttgtcggccatcacagaccgtgct
gttttccccgagtccatcaccgaggaagggtggcgcgaagctcgcatcgagaccgccgcc
gaggctgctgaccgcgccggcagaatcgccaagtggatccgcgatacccacaatgatgac
gagtgcatcgcgatcgtcgctcacggcgcgatcggatccatgatgttgctgcatctcatc
gccccacaacttgccgctggtctgcgaaaccactccatcggcagcgaaccgcactggatc
gggcttcagaacaccgccacctcgatgatcgagttgcacccggacgggtacgaagttcat
tggatcaatcgcgtggatcaccttatcgaagccggtatggttcacggcgccgtcgccgca
tccaccggcaaccccggtacccgctga

DBGET integrated database retrieval system