KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_04115Help
Entry
TIA2EST22_04115   CDS       T01654                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST22_04115 (tpiA)
   01230 Biosynthesis of amino acids
    TIA2EST22_04115 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST22_04115 (tpiA)
   00051 Fructose and mannose metabolism
    TIA2EST22_04115 (tpiA)
   00562 Inositol phosphate metabolism
    TIA2EST22_04115 (tpiA)
Enzymes [BR:pav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TIA2EST22_04115 (tpiA)
Exosome [BR:pav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TIA2EST22_04115 (tpiA)
  Exosomal proteins of bladder cancer cells
   TIA2EST22_04115 (tpiA)
  Exosomal proteins of melanoma cells
   TIA2EST22_04115 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
889387..890166
Genome map
AA seq 259 aa AA seqDB search
MSRTPIMAGNWKMNLDHVAATSLVQDLGEALKAAGYDSSKSEAVVIPPFTDIRPVAIIID
GDKLPIAYGAQDISAHDDGAYTGEVSGAMLSKLGCRYVVVGHSERREYHNESDELVNAKA
KKVIENGMTPIICCGEALEVRKAGKHVEHTVGQIKADLDGISAEQVAKLVIAYEPIWAIG
TGETATADDAQEVCQAIREAVKELYDAPTAEAVRIQYGGSVKPANVAEIMAKPDVDGALV
GGASLKAGDFSKIVTFYEA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaccccgatcatggccggcaactggaagatgaacctcgaccacgttgctgct
acctccctcgtccaggatctcggtgaggccctcaaggccgcgggatacgactcctccaag
tcggaggccgtcgtcatcccgccgttcaccgatatccgtcctgttgccatcatcattgat
ggcgacaagttgccgatcgcctacggtgcccaggatatttcggctcacgacgatggcgct
tacaccggcgaggtgtccggcgccatgctgtcgaagctgggttgccgctatgtcgtcgtt
ggccactccgagcgtcgcgagtaccacaacgagtccgacgaactggtcaatgccaaggct
aagaaggtcatcgaaaatggaatgaccccaatcatctgctgtggcgaggccctcgaggtt
cgcaaggctggcaagcacgtcgaacataccgttggccagatcaaagccgaccttgacggc
atttctgccgagcaggtcgccaagcttgtcattgcctacgagcccatctgggccatcggc
actggcgagactgccaccgctgacgatgcccaggaggtctgccaggccatccgcgaggcc
gtcaaggagctttacgacgccccgaccgccgaggcggtgcgcattcagtacggtggttca
gttaaaccggccaacgtcgctgagatcatggccaagccagacgttgacggcgctctcgtt
ggcggagcctcgctcaaagctggcgatttctccaagattgtaactttctacgaggcctga

DBGET integrated database retrieval system