KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_04530Help
Entry
TIA2EST22_04530   CDS       T01654                                 

Definition
putative Acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST22_04530
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST22_04530
   00620 Pyruvate metabolism
    TIA2EST22_04530
   00640 Propanoate metabolism
    TIA2EST22_04530
  Energy metabolism
   00680 Methane metabolism
    TIA2EST22_04530
Enzymes [BR:pav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TIA2EST22_04530
Lipid biosynthesis proteins [BR:pav01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TIA2EST22_04530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965903..966685
Genome map
AA seq 260 aa AA seqDB search
MRKHDLSSLRVLCSVGESINPEAWRWFHDVVGDGTCPITDTWWQTETGMFQITTVPSMPL
KPGAVGRPVFGQEAAVVDEEGHELPAGKEGFLVLKNPWPAMMRTLYKDPDRYLEAYWTKY
PGVYLTGDSARIDDDGYIWIIGRADDVIKVSGHRIGTAEVESALIFHPAVAEAAAIGLPH
EVKRNAIHMVVVLNHSFEPTKNLVSDIRGHVAETLSPIAKPDTIEFVDKLPKTRSGKIVR
RVLKARVLGGDEGDLSTLED
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaacacgatctgtccagtttgcgcgtactctgttcggttggcgagtccatcaac
ccggaggcttggcgctggttccacgacgtggtcggtgacggcacgtgtccgatcaccgat
acctggtggcagaccgaaactggcatgttccagatcaccactgtgccgtcgatgccgctc
aaaccaggtgccgttgggcgtccggtctttggccaggaggctgctgttgtcgacgaggag
ggccatgagctccctgcgggcaaagagggcttcctcgtcctcaaaaacccgtggccggcc
atgatgcgcaccctgtataaggatccggatcgatacctcgaggcgtactggacgaagtac
ccgggtgtctatctcaccggtgattccgcacgaatcgatgatgacggctacatatggatc
atcggacgtgctgacgacgtcatcaaggtatccggtcaccgcatcggtactgctgaggtg
gagtccgctctgatctttcaccccgccgtcgccgaggctgcggccatagggctgcctcac
gaagtgaagcgcaacgcgatccatatggtcgttgtactcaatcatagtttcgagccgacg
aagaatctcgtctctgatatccgcggacacgtcgccgaaaccctctcgccgattgccaag
cctgacaccatcgagttcgtcgacaagttgccgaagacccgctccggcaagatcgtgcgt
cgcgtcctcaaagctcgtgtcctgggtggagacgagggagacctgtcaaccctagaggac
tga

DBGET integrated database retrieval system