KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_04530Help
Entry
TIA2EST22_04530   CDS       T01654                                 

Definition
(GenBank) putative Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00010  Glycolysis / Gluconeogenesis
pav00620  Pyruvate metabolism
pav00640  Propanoate metabolism
pav00680  Methane metabolism
pav01100  Metabolic pathways
pav01110  Biosynthesis of secondary metabolites
pav01120  Microbial metabolism in diverse environments
pav01130  Biosynthesis of antibiotics
pav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST22_04530
   00620 Pyruvate metabolism
    TIA2EST22_04530
   00640 Propanoate metabolism
    TIA2EST22_04530
  Energy metabolism
   00680 Methane metabolism
    TIA2EST22_04530
Enzymes [BR:pav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TIA2EST22_04530
Lipid biosynthesis proteins [BR:pav01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TIA2EST22_04530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEW81226
Position
965903..966685
Genome map
AA seq 260 aa AA seqDB search
MRKHDLSSLRVLCSVGESINPEAWRWFHDVVGDGTCPITDTWWQTETGMFQITTVPSMPL
KPGAVGRPVFGQEAAVVDEEGHELPAGKEGFLVLKNPWPAMMRTLYKDPDRYLEAYWTKY
PGVYLTGDSARIDDDGYIWIIGRADDVIKVSGHRIGTAEVESALIFHPAVAEAAAIGLPH
EVKRNAIHMVVVLNHSFEPTKNLVSDIRGHVAETLSPIAKPDTIEFVDKLPKTRSGKIVR
RVLKARVLGGDEGDLSTLED
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaacacgatctgtccagtttgcgcgtactctgttcggttggcgagtccatcaac
ccggaggcttggcgctggttccacgacgtggtcggtgacggcacgtgtccgatcaccgat
acctggtggcagaccgaaactggcatgttccagatcaccactgtgccgtcgatgccgctc
aaaccaggtgccgttgggcgtccggtctttggccaggaggctgctgttgtcgacgaggag
ggccatgagctccctgcgggcaaagagggcttcctcgtcctcaaaaacccgtggccggcc
atgatgcgcaccctgtataaggatccggatcgatacctcgaggcgtactggacgaagtac
ccgggtgtctatctcaccggtgattccgcacgaatcgatgatgacggctacatatggatc
atcggacgtgctgacgacgtcatcaaggtatccggtcaccgcatcggtactgctgaggtg
gagtccgctctgatctttcaccccgccgtcgccgaggctgcggccatagggctgcctcac
gaagtgaagcgcaacgcgatccatatggtcgttgtactcaatcatagtttcgagccgacg
aagaatctcgtctctgatatccgcggacacgtcgccgaaaccctctcgccgattgccaag
cctgacaccatcgagttcgtcgacaagttgccgaagacccgctccggcaagatcgtgcgt
cgcgtcctcaaagctcgtgtcctgggtggagacgagggagacctgtcaaccctagaggac
tga

DBGET integrated database retrieval system