KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_04955Help
Entry
TIA2EST22_04955   CDS       T01654                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TIA2EST22_04955 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TIA2EST22_04955 (pyrB)
Enzymes [BR:pav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TIA2EST22_04955 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1054565..1055509
Genome map
AA seq 314 aa AA seqDB search
MSTEVVEEFDADYTGRHFLSVEDMSSDDVMRIIERGRQFKAGDAPRVEPGHVAINMFFEN
STRTMTSFQMAEHRLGMKILDFDPGHSSVTKGESLYDSVRTVDAIGAEVAVIRHSTNHYY
DYLLATGMLGLSVVNGGDGSGQHPSQCMLDLMTIAEEFGHVDGLTVAISGDIVHSRVARS
DAQILTRLGANVVFTGPREWMDHDVTRLGTMATLDEVIADVDVAMMLRVQHERFDAGPDF
SATDYLHTFGLTDERAERMKPHAIIMHPAPVNRGCEISGHLVEAPSSRIFEQMGNGVMVR
MAILEQVLHGRETK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaggttgttgaagagttcgacgccgactacaccggacgtcactttttgtcg
gtcgaagatatgtccagtgatgacgtcatgcggatcatcgagcgtggtcggcagttcaag
gccggtgacgctccgcgcgtggagccgggtcacgtcgctatcaacatgttcttcgagaac
tccacccgaacgatgaccagctttcagatggctgagcaccgtctcggcatgaagatcctc
gacttcgatccgggccactccagcgtcaccaagggggagagcctctacgactcggtgcgc
accgtcgacgccattggcgccgaggttgccgtcatacgtcactccaccaaccactactac
gattacctgctcgcaaccgggatgctcggcctgtcggtcgtcaatggtggggatggatct
ggtcaacaccctagtcagtgcatgctggacctcatgactatcgctgaggagtttggccat
gtcgacggtctaacggttgcgatcagcggcgatatcgtgcactcgcgagtagctcgttct
gatgctcaaatccttaccaggcttggggccaacgttgtctttactggaccgcgtgagtgg
atggaccatgacgtcacccgacttggcacgatggcgactctcgacgaggtcattgctgat
gtcgacgtcgcgatgatgctacgcgtccagcacgagagattcgatgctggcccagacttc
tctgcaactgattacttacatacgtttgggctcacagacgagcgcgcagagcgaatgaag
cctcatgcgatcatcatgcacccggctcctgtaaaccgaggatgtgaaatttccggtcac
ctcgtagaggctccctcgtctcgtatttttgagcagatggggaacggagttatggtgcga
atggctattttggaacaggtgttgcacggcagggagacaaaatga

DBGET integrated database retrieval system