KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_05520Help
Entry
TIA2EST22_05520   CDS       T01654                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00500  Starch and sucrose metabolism
pav01100  Metabolic pathways
pav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TIA2EST22_05520
Enzymes [BR:pav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TIA2EST22_05520
Exosome [BR:pav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TIA2EST22_05520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70 DUF3459
Motif
Other DBs
NCBI-ProteinID: AEW81420
Position
complement(1181275..1183209)
Genome map
AA seq 644 aa AA seqDB search
MAHDEFGGLTGWDLEGFHSGGDTEVWKRLGSHVVTIDDDERGPITGTRFAVWAPNAQAVE
VISDFNWWTGDRMRLIPGSGVWGTFVEGVDEGTLYKFRIQDQWGTWHEKVDPMARYSEQA
PQNASIVNETHYEWNDDEWIARREASRAHAEPMSVYEVHLGGWRHGLSYRELADQLVSYV
TWQGYTHVEFMPLAEHPFAPSWGYQVTGYFSPTSRYGSPDDLRYLIDKLHQAGIGVIMDW
VPGHFPKDDWALGRFDGTALYEHADPRQGEHKDWGTYIFNYGRNEVKSFLVSSALYWISE
FHADGLRVDAVASMLYLDYSREEGQWVPNKYGGRENLEAIDFLRYVNSHLYSRHPGILMI
AEESTSFPGVTKPVDDGGLGFGFKWNMGWMNDSLRYLELNPFHRQYHHGEMTFAMVYQYS
ENFILPISHDEVVHGKGSMITKIPGDDWQQFASLRAFYSYMWSFPGKQLVFMGQEFGQRH
EFDESVSLEWFVADLWGHGGLKRLFRDLNKIYKENPALWQLDSDPRGFEWINADDAGNNL
FSWLRRSDDGSTIACFTNFSPNPQTDYRIDLPMEGVWTEILNTDSLEYDGTGEFGNLGQI
VAAPLPAPDRLRAVATVCVPPMGSVWLRHNPSATAALPGDPGVQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgatgagttcggaggactcaccggttgggacctcgaggggttccactctggt
ggggacacggaggtgtggaagaggctcgggtcccatgtcgtcactatcgacgacgatgag
cgcggtcccatcaccggcacccgcttcgctgtgtgggccccaaatgcccaggcggttgag
gtcatctctgacttcaactggtggactggtgaccgtatgcgcctcatcccggggtccgga
gtctggggcaccttcgtcgaaggagtcgacgagggaaccctctataagttccgcattcag
gaccagtggggtacctggcacgaaaaggttgacccaatggcccgttattcagagcaagct
cctcagaatgcttccatcgtcaacgaaacccactacgaatggaatgacgatgagtggatc
gcccgccgcgaggcctcccgcgctcacgccgaaccgatgagcgtctacgaggtccatttg
ggcggatggcgtcacgggctgagctaccgagagttggctgaccagctggtgagctatgtc
acttggcagggctatacccatgtggagttcatgccattggctgaacacccattcgctccc
tcctggggataccaggtcaccgggtacttctctcccaccagccgctacggatctcccgac
gacctgcgttacctcatcgataagctacatcaggccggcatcggagtcatcatggattgg
gttcccggccactttcccaaggacgactgggccctggggcgcttcgacggcaccgcgctt
tacgaacacgccgatccacgccagggcgaacacaaggactggggaacctacatcttcaac
tacggtcgcaacgaggtgaaatctttcctcgtctcaagcgcgctgtactggattagcgaa
ttccacgccgacggactgcgcgttgacgccgtcgcctcgatgctctacttggactactct
cgcgaagagggccagtgggtgcccaacaagtatggcggccgggagaacctagaggccatt
gacttcttgcgctatgtcaactctcacttgtattcgcgccaccccggcatcctcatgatc
gctgaggagtccactagtttccccggcgtcaccaagccggtcgacgacggtgggctgggg
ttcgggttcaagtggaatatgggctggatgaacgactcgctgcgatatctggagctcaac
ccattccaccgccagtaccaccatggcgagatgacctttgccatggtctaccaatactca
gagaacttcatcttgccgattagccacgacgaggtcgtgcatggcaaaggatccatgatc
accaagattcccggtgacgactggcaacagttcgcgtccctgcgagccttctactcctac
atgtggtcttttcccggcaaacagctggtgttcatgggtcaggaatttggtcagcgccac
gagttcgacgagtcggtaagccttgagtggtttgtcgccgacctgtggggacacggcggt
ctcaaacgcctcttccgcgaccttaacaagatttacaaagaaaaccccgcattgtggcag
ctcgacagcgatccgcgcggattcgagtggatcaacgccgacgatgccggtaacaacctg
ttctcctggttacgccgttccgatgatggatcgacgattgcctgcttcacgaacttctct
cccaatccgcagaccgactatcgtatcgacctaccgatggaaggggtgtggaccgagatc
ctcaacaccgattccctggagtacgacggcaccggcgagttcggcaatctcggccaaatc
gtagccgccccactgccagctcccgatcgtctccgtgcggttgccacagtgtgcgttccg
ccgatgggatcggtgtggctacgtcacaatccgtcagcaaccgctgccctgcccggcgat
ccgggcgtgcaatga

DBGET integrated database retrieval system