KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_05615Help
Entry
TIA2EST22_05615   CDS       T01654                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIA2EST22_05615
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TIA2EST22_05615
Enzymes [BR:pav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TIA2EST22_05615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201609..1202409
Genome map
AA seq 266 aa AA seqDB search
MPPTVTGTVLDGIISGVLEDLHERQLMVTSDNLREATELVAPAIDPIPRLTAPGLSVISE
IKRSSPSNGQLAAIHDPAALADQYRSGGAAAISVLTEERRFQGSLADLDAVRAKVEIPVL
RKDFVVAEYQVLEARAHGADLILLIVAALSDDDLQRLYDLAIELGMTPLVEVHTPEEVSR
ATALGARVVGVNARNLKTLEVDKTIFRELLGELPENVVKVAESGILCVDEAVEVYDLGAD
AVLVGEMLVRHGEPAQVLRKIHRATV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccactgttaccggaacggtccttgacggaatcatttccggtgttctcgaagat
cttcatgagcgccaactcatggttacctcggacaatcttcgtgaggccactgagctcgtg
gcccctgctatcgatccgatcccgaggctgacagcgcctggcctgtcggttatctcagaa
atcaagcggtcgagcccgtcaaacggccagctggctgctattcatgaccctgccgcactg
gctgatcagtaccgctccggtggagccgctgctatcagcgttctgactgaggagcgccga
tttcaaggatccctggccgaccttgacgcggtgcgtgcgaaagttgagatcccagtactc
cgcaaggatttcgttgtcgcggaataccaggtgctcgaagcccgtgcacacggggcagac
cttatcctcctcatcgttgccgcgttatctgacgacgacttgcaacgcctatatgacctt
gccatcgagctgggcatgaccccgctagttgaagttcatacccctgaagaggtaagtcga
gctacagcccttggtgcccgtgtggtgggtgtgaatgcgcgcaacctcaagaccctcgaa
gtcgataagaccattttcagggaactccttggtgagctgcctgaaaacgtcgttaaggtg
gcggaatccggaattctttgcgtggacgaggccgtcgaggtatatgaccttggtgctgac
gcggtgttggtgggggagatgctggtccgccacggtgaaccagcacaagtattgcgcaag
atccaccgtgccaccgtgtga

DBGET integrated database retrieval system