KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_05620Help
Entry
TIA2EST22_05620   CDS       T01654                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIA2EST22_05620
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIA2EST22_05620
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TIA2EST22_05620
Enzymes [BR:pav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TIA2EST22_05620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1202437..1203693
Genome map
AA seq 418 aa AA seqDB search
MSARDLPDARGHFDRFGGRFVPEALQAALSQLTGTFEAAVTDPDFLTELEDLRREYAGRP
SPLTEAPRFSQYIFQQTGHQVRVLLKREDLNHTGSHKINNVLGQALLTRKMGKRRLIAET
GAGQHGVATATVAAMMGMECRIYMGQIDTERQALNVARMQLLGAEVIAVEAGSRTLKDAM
NEAMRDWVAHVEDTHYLIGTASGPHPFPKLVREFQRVISAEARQQCLDRVGRLPDAICAC
VGGGSNAIGSFAEFIDDPEVRLYGFEAGGDGVETGRHAASITRGSVGVLHGTRTYILQDP
DGQTMESHSISAGLDYPGVGPEHSWLAARKRATYLPVNDREAMEALRTLTRTEGIMPAIE
SAHAVAGVLKIAKDLPAHDGEPSVVIVTVSGRGDKDVDTALKWFAMDGSVDATTGGME
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacgagacttgcccgacgctcggggacacttcgaccgtttcggtggccgattc
gttccagaagctctccaagctgctcttagccagcttacggggaccttcgaggccgcggta
accgatcctgactttctcactgagctggaggatctgcgccgggagtacgccggacgcccc
tctccgcttacagaggcaccgcgattttctcaatacatctttcaacagaccggtcatcag
gtgcgagtccttctgaagcgcgaggacctgaaccacaccggttctcacaagatcaacaat
gtgttgggccaagccctgctgactcgaaagatgggcaagcgccgtctcattgcggagacg
ggagctggacagcatggcgtggcgacggcaaccgtggccgcgatgatgggcatggagtgc
cggatctatatgggccagatcgacactgagcgtcaggccctcaatgtggctcgcatgcag
ctgttgggcgccgaggtcattgcagtggaagccggctcgcgcacgttgaaggacgccatg
aacgaggccatgcgagattgggtggcccatgttgaggacacccactacctcatcggtacc
gcttctgggccacacccgttccctaaactggtgcgagagtttcagcgggtcatttctgcg
gaggcccgtcagcagtgccttgatcgggttggacgccttcccgacgccatttgtgcgtgt
gtcggtggtgggtcgaatgccatcggatcgttcgccgagttcatcgacgaccccgaggtt
cgtctctacggtttcgaggcgggcggtgacggtgtcgagaccggtcgccatgcagcatcg
atcaccaggggttccgttggtgtactgcacggcactcgcacctacattctgcaagatccg
gacggccagacgatggaatctcactccatatcggccggcctggactatcccggagttggc
cccgaacattcttggttagcggcccggaagcgtgctacttacctcccggtcaacgaccgc
gaggccatggaggctctacgtaccctcacccgcaccgaaggcatcatgccggccattgag
tcggcccacgctgtcgccggcgttcttaagatcgcgaaagacctgcctgctcacgacggc
gagccgtcagtggtcatcgtcacggtgtcgggtcgcggggataaagatgttgacactgcc
ctgaagtggtttgccatggacggcagcgtcgacgccactacgggaggtatggaatga

DBGET integrated database retrieval system