KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_05625Help
Entry
TIA2EST22_05625   CDS       T01654                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pav01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pav00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pav00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1203690..1204187
Genome map
AA seq 165 aa AA seqDB search
MTGSASVYLRAHQENRPALVGYFPVGHPSVPHSIDAMKALTTGTTGTGVDLVVIGMPYSD
PMMDGTVIQHVTTGALERGVRTRDTLLATEAVAGTGTPCVIMTYWNLVEHYGVDAYARDL
ASAGGSGLTTPDEAEDRGDSVTVGIDRMCAIVDDLAAGVRRAERQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtagcgccagtgtctacctcagggcccaccaagagaaccgcccggccctcgtc
ggttacttcccggtgggacacccgtcagttcctcactcgatcgatgctatgaaggcactg
actacgggcactactgggaccggtgtcgacctcgtcgtgatcggaatgccttactccgac
ccgatgatggacggcaccgtcattcagcacgtcactaccggggctctagagcgcggggta
cgcactcgcgacaccctattggccacagaggccgtggccgggaccggaactccgtgcgtg
attatgacctattggaaccttgtcgagcactacggtgtcgacgcttatgctcgcgatctg
gcatccgcgggtggctcagggctcaccacccccgatgaggctgaggatcggggggactca
gtgacggtaggaattgaccggatgtgcgccatcgtcgacgacctggcggccggagtacgg
cgggcggaacgccagtga

DBGET integrated database retrieval system