KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_05690Help
Entry
TIA2EST22_05690   CDS       T01654                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pav00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1220276..1221706
Genome map
AA seq 476 aa AA seqDB search
MKRILWGGATAASQYEGGFYDGKGMDTQDCRRWIPRLSNDTIQTRLLTEADIRNAKNSRS
DDCRFPFRMGSRGYEYWESDLHYITSLGLDVYRLSISWARLFPTGFEDQPNPEGVMYYDR
IIRTLAHAGIKVFITINHYAMPIAIVDKYGGWRHRDVIDLYLKMAKFVVDRWQENVDYWL
PVNEINSGYFSPYNGLGIIGTIDYSYDYRSVFNGLHYQMIASALITKYGRDIGARGKFVC
MVSCFDYYALHPTPEDNMKLVHDEQINQWWCADVLATGEYGYYTEKFLADHGVVLDITDK
DRGILRSNTCDIVSFSYYSSSICSVDEKREQVPGNLVPTLRNPSLEATEWGWQIDPMGLR
ITAHKVYDRYRKPIMVAENGLGARDNVDSDGRIHDNYRISYLERHMEQAELAVREGVDIE
AYFVWGIIDIVSAGSCEMEKRYGVVYVDADNEGRGTYKRLPKDSFYWYRDFIASHR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattctgtggggtggggctaccgcggccagtcaatatgaaggcgggttctac
gacggaaagggaatggacacccaagactgtcgtcgatggattccgcggctatcgaatgat
acgatacaaactcgtctcctcaccgaggctgatattcgaaatgcaaagaattctcgttct
gacgactgccggttcccgttccgtatgggatcgcggggttacgaatactgggaatcagac
ttacactacattaccagtcttggcctagatgtatatcgtctttcgattagctgggcccgt
ctatttcccactggtttcgaggaccagcccaatccggaaggggtgatgtactatgaccgg
attattcgcacccttgcacatgctggaattaaagtcttcatcacgatcaatcactatgcg
atgccgattgcgatcgttgacaagtacggaggttggcgacatcgtgacgtcatcgatctg
tatcttaagatggcgaaatttgtcgtcgatcgctggcaagaaaatgtagactattggctt
cctgtaaacgagattaattccgggtatttcagtccttataatggactcggaataatagga
accatcgattactcctatgattatcggtcagtctttaatggtcttcattaccaaatgata
gcaagcgccctcataacaaaatacggtcgcgatatcggagcacgaggaaagttcgtgtgc
atggtgagctgtttcgattactatgcgctccatcccacacctgaggacaacatgaagctc
gttcacgacgagcagatcaatcagtggtggtgtgcagatgtactagcaacaggtgaatac
gggtattacacagagaagttcttggccgaccatggggtagtactcgacatcacggacaag
gaccgtggcatactcaggtcgaatacctgtgacatcgtgtcattttcgtactattcatcg
tcgatttgtagtgtagacgaaaaacgtgaacaagtccctggaaacctggtaccaacattg
agaaaccctagtttggaagctaccgagtggggatggcagatagaccccatgggtttgagg
attacggctcacaaggtttacgaccggtaccggaagcccataatggttgctgagaatgga
ttgggtgcgcgggataatgtcgactctgatgggcgtatccacgataattatagaatatca
tatctcgagcgccatatggaacaggctgagcttgccgtgcgggagggtgtagatatagaa
gcatatttcgtttggggcatcattgacatcgtcagtgccggtagttgcgaaatggagaaa
aggtacggtgtcgtctatgtcgacgcagacaacgaagggcggggaacttataaacggttg
ccgaaagatagtttctattggtatcgcgacttcatcgcctctcataggtga

DBGET integrated database retrieval system