KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_05705Help
Entry
TIA2EST22_05705   CDS       T01654                                 

Definition
PTS system, Lactose/Cellobiose specific IIA subunit
Orthology
K02759  
PTS system, cellobiose-specific IIA component [EC:2.7.1.69]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Phosphotransferase system (PTS)
Module
PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:pav00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    TIA2EST22_05705
Enzymes [BR:pav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     TIA2EST22_05705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1223316..1223681
Genome map
AA seq 121 aa AA seqDB search
MTSQCGSDSPDGGAVMSEIETAIFTIITSAGEARASLYQALDKARAGEMAESEQCMIEAD
TQLKKAHDVQTELITRDLNGSLPMSLLLVHAQDQLMTTMSEQSLIEHMIGLIRDIGMNGG
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacagtgtgggagtgacagcccggatggtggggcggtgatgtcagagatcgaa
actgccatttttaccatcatcacgagtgctggtgaggcgcgtgcgtcgctgtatcaggct
cttgacaaagctcgggctggtgagatggctgagagtgaacaatgcatgattgaggcggac
acacagttgaagaaggcccatgatgtgcagaccgagctcatcacgcgtgatctcaacggc
tcgctgccgatgtcgcttttgctcgtccatgcccaagatcagttgatgacgacgatgtca
gaacagtctctcattgaacacatgattgggctaattcgagacataggtatgaacggaggg
aagtga

DBGET integrated database retrieval system