KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_05705Help
Entry
TIA2EST22_05705   CDS       T01654                                 

Definition
PTS system, Lactose/Cellobiose specific IIA subunit
Orthology
K02759  
PTS system, cellobiose-specific IIA component [EC:2.7.1.69]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Phosphotransferase system (PTS)
Module
PTS system, cellobiose-specific II component
Class
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:pav02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1223316..1223681
Genome map
AA seq 121 aa AA seqDB search
MTSQCGSDSPDGGAVMSEIETAIFTIITSAGEARASLYQALDKARAGEMAESEQCMIEAD
TQLKKAHDVQTELITRDLNGSLPMSLLLVHAQDQLMTTMSEQSLIEHMIGLIRDIGMNGG
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacagtgtgggagtgacagcccggatggtggggcggtgatgtcagagatcgaa
actgccatttttaccatcatcacgagtgctggtgaggcgcgtgcgtcgctgtatcaggct
cttgacaaagctcgggctggtgagatggctgagagtgaacaatgcatgattgaggcggac
acacagttgaagaaggcccatgatgtgcagaccgagctcatcacgcgtgatctcaacggc
tcgctgccgatgtcgcttttgctcgtccatgcccaagatcagttgatgacgacgatgtca
gaacagtctctcattgaacacatgattgggctaattcgagacataggtatgaacggaggg
aagtga

DBGET integrated database retrieval system