KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_06100Help
Entry
TIA2EST22_06100   CDS       T01654                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TIA2EST22_06100
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TIA2EST22_06100
Enzymes [BR:pav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     TIA2EST22_06100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1308589..1310115)
Genome map
AA seq 508 aa AA seqDB search
MDNITPASVGRLIRDARKQHGMTQNQLAEILKTSQSAIHRVESGTQNLSLEYINRIAEAL
ESPIITQPGSGTMNYRIEGGHQLSGSIEVRSSKNAAVALLCACLINRGRTVLRGIAHIEE
VNRILEVLTSIGVTYEWSDDEHDLTLIRPAELNLDDMDIEAARRTRSVIMFLGPLMRFYD
TFKLPYAGGCNLGARTVEPHLQVLRAFGLDVVATEGFYQCHVTDHTVKERHIVLTERGDT
VTENALLAAAQTPGVTVLRNASSNYMVQDLCVFLCQLGVQIEGIGTTTLRIRGVEEIDVD
VEYAPSEDPIEAMSLLTAAVVTKSELTITRCPIEFLEIELAILSEMGLDFDLSPEYVSRN
GFTRLVDVTVRPSKLRAVADKIHPMPFPGLNIDNLPFFAVIAAEAEGQTLIHDWCYENRA
IHLLDLGKLGADVQLLDPHRLIVRGPTRWRGRELICPPALRPAVCLLLAALAASGETTLR
DVYMINRGYEDLPTRLGALGAKITVFHG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacatcaccccagcttcggtcggtcgtcttatccgcgacgcacgcaagcagcat
ggaatgacgcagaaccaattggcggagatcctgaagacctcccagagcgctatccaccgg
gtggaatcaggcacgcagaacctctctctggagtacatcaaccgcatcgcggaggcgtta
gagtctcccatcatcacccagccgggaagcggtaccatgaattaccgcatcgaaggaggt
catcaactttcgggctctatcgaggtgcggtcctccaaaaacgcggccgtcgcgctgcta
tgcgcctgtctcatcaacaggggccgtaccgtgctacgcggtatcgcccacatcgaggag
gttaaccgcattcttgaggtgctgacctccatcggcgtcacctacgagtggtctgacgac
gagcatgatctcaccctgattcgtccggctgagctcaaccttgacgatatggacatcgag
gctgcccgacgtacccgaagcgtcatcatgttcctcggaccgttgatgcggttctacgac
accttcaaactcccctacgccggcggctgcaacctcggcgctcgaactgtcgaacctcac
ctgcaggtgctacgtgctttcggccttgacgttgttgccaccgagggcttttaccagtgc
cacgtcaccgatcacaccgtcaaggagcgtcacatcgtcctgactgagcgtggcgacact
gttaccgagaatgctctgctggctgccgcccagacccccggcgtgactgtgctgcgtaat
gccagctcgaactatatggttcaggacttgtgcgtgttcctatgccagctcggtgtgcag
attgagggcatcggaacgacgaccttgcgaatccgcggcgttgaagagatcgacgttgat
gtcgagtacgccccgtctgaagatccgattgaggctatgagcctcctcacggcggcggtc
gtcaccaagtcggagctgacgatcacacgctgcccgatcgaattccttgaaattgagctg
gcgatcctgtctgagatgggtctggatttcgacctctcccccgagtacgtctctcgcaac
gggttcacccgtctcgttgatgtcacggtgcgccccagcaagttgcgagcggtagctgac
aaaatccacccgatgcccttcccgggcctcaacatcgacaacctaccgttctttgcggtt
attgctgcggaggcagaaggccagaccctcatccatgactggtgctacgagaatcgtgcg
atccacttgctcgacttgggcaaacttggcgctgacgttcagctgctcgatccgcaccgt
ctcatcgtgcggggcccgacccgttggcgtggtcgcgaactcatctgcccgccggccttg
cgtcctgccgtctgtctgctattggccgctctggccgcttcgggagaaacgaccctgcgc
gacgtctacatgatcaaccgcggttacgaagatctcccgacccggcttggggcgttggga
gccaagatcaccgtcttccatggctga

DBGET integrated database retrieval system