KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_06250Help
Entry
TIA2EST22_06250   CDS       T01654                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00260  Glycine, serine and threonine metabolism
pav00750  Vitamin B6 metabolism
pav01100  Metabolic pathways
pav01110  Biosynthesis of secondary metabolites
pav01120  Microbial metabolism in diverse environments
pav01230  Biosynthesis of amino acids
Module
pav_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIA2EST22_06250
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TIA2EST22_06250
Enzymes [BR:pav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TIA2EST22_06250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEW81564
Position
complement(1335612..1336688)
Genome map
AA seq 358 aa AA seqDB search
MIMSQQNRLFGVIETYRDRLPMDGIDQIVTLGEGATPLVPAPRLGAELDATVWVKVEGAN
PTGSFKDRGMTMAMTKALADGSKAVVCASTGNTSASASAYASRAGMTPVVLLPQGKIAAG
KLAQAVVHGGRIIQILGNFDDCLRIARELAENFPVSLVNSINPYRIEGQKTAAFEVVDVL
GDAPDIHALPVGNAGNITAYWKGYREYVADGPASHTPRMFGFQAAGAAPLVLGHDVNDPE
TVATAIRIGRPASGKLALAARDESEGLIDAVTDEQILDAQTFLAAREGIFVEPASAVGVA
GLFKLKSEGRLDPGLRIVVTVTGNGLKDIDTALSRTTWSTEAVEASTDQVAALLDFCS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatgagccagcagaatcgtctcttcggcgtgattgagacctatcgagaccgtctc
cctatggacggaattgaccagatcgtgacgttgggggagggggcgaccccgttggtgcct
gccccacgattgggcgccgagcttgacgcgacggtatgggttaaagttgaaggggccaat
ccgaccggatcgttcaaggatcgtggcatgacgatggccatgacgaaagcccttgccgac
ggctcgaaagccgtggtgtgtgcctctaccggtaatacctctgcctcggcatcggcttac
gcctcccgagccggcatgactccggtcgtgctccttccccagggcaagattgcagctggc
aaactcgcccaggctgttgtccatggcggtcgaatcatccagattctcggcaacttcgac
gattgcctgcgtattgcccgcgagctggccgagaatttcccggtctccctggtgaactcg
atcaatccgtaccgcatcgagggacagaaaactgctgcctttgaggtcgttgacgttctt
ggtgacgctcctgatatccacgctcttccggtgggcaacgcaggcaatatcaccgcctat
tggaagggttaccgcgagtacgtagcggacggtcctgccagccacacgccgcggatgttc
ggattccaagccgctggcgcagcccccctggtgctgggccacgacgttaatgacccggaa
acggtagccaccgctattcgtatcggtcgtccggcctccggcaagctggcgttggccgct
cgagacgagtcggaggggctcatcgacgctgtcacggacgagcaaattcttgacgcccag
actttcctagctgctcgagagggcatttttgttgagccggcatcagcagtcggagtggca
ggtttgttcaagttgaagtccgagggacgcctggatcctggactgcgcatcgtcgtcacg
gtaactggaaacggtctgaaggacattgacactgcattgagtcgcactacctggtcaacc
gaggctgtggaagcttcgactgaccaggttgccgctttgttggacttctgttcctga

DBGET integrated database retrieval system