KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_06560Help
Entry
TIA2EST22_06560   CDS       T01654                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pav00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TIA2EST22_06560
Enzymes [BR:pav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TIA2EST22_06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1403987..1405873
Genome map
AA seq 628 aa AA seqDB search
MTDLVPVAAGSRLEPFARAGVLEASDIHLANLVCRIGGETNCDVSLAIALSCRELRRGSV
FWDPHEIANVVRQQILDPAIPDIETSDQAALFAELEWPPPGEWLSTLEASPVIAGRDDPL
NRLPARLDDGLVYLEKYWQAEHDVARDLATLAADPPSQGPVSADDVVSSISNALAASGIM
LDPAQADAAIAAIMHRVSVLAGGPGTGKTTTVCALLAALQQADPHLGAVALAAPSGKAAA
RLRDSVSQVSERMPDDLKPIVADATTVHSLLKWQGPGTSFGYDEQHKLPFGVVVVDEASM
LSLPLAASLLSAIGPQTRLILVGDPGQLVSVDAGSVLADIVSSADALQAQLPVTILTCNH
RSRGDIARLSEAVREGDKSTALDVLATAAGVTHDSPSPDSIATISGRRSITWIDADPASI
TMADLPAVAEVIARTGARMLELAQASADAAALKLVDAHRLLCAHREGPYGVDEWSQRMVT
VLSDVLPGVGQGRWVLGETAIVTHNLAQLGVNNGDCGVIVETRPVPTIALPGPGGVPRRL
PCSLIPSLQPLQAMTIHKAQGSQFTDVTVVLPPPDSPLLSRELLYTAITRAREHLTVVGT
RESVERAIDRANDRRSGIQRRWEESRTS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctcgtcccggtagcagcaggaagtcggctcgagcccttcgcccgagccgga
gtcctcgaggccagcgacatccatttagccaatctagtgtgccgcatcggtggcgagacc
aactgcgatgtcagcctcgccatcgctttatcatgccgtgagcttcggcgcgggtccgtg
ttctgggacccacatgaaatcgcaaacgtcgtccgccagcaaatccttgatccggcaatt
ccagacatcgaaaccagcgaccaggcagccctattcgcggaattggaatggccacctcca
ggcgagtggctgtccacgctagaggccagtcccgtcattgctggccgtgatgatccgctc
aaccggttgccggctcggcttgatgatggcctggtctacctagagaaatattggcaagct
gagcatgatgtcgcccgcgatctcgctaccctcgctgcggatccgccaagccaaggccca
gtgtcggccgacgatgttgtttccagcatcagtaatgccttagcagcatccggaattatg
ttggatccagctcaagctgatgctgccatcgccgcaattatgcaccgagttagtgtgctt
gcaggtggccccggaaccggcaagacaactacggtatgcgccctcctagctgccttgcaa
caggctgaccctcatcttggagccgtggcccttgcggctcccagcggcaaagcagcggca
cgcttgcgtgactcagtttcgcaagtttcagagcgaatgcccgatgacctgaaaccgatt
gttgctgacgcaactaccgtccactcactgctgaaatggcaggggccgggaacctcattt
ggatatgacgagcaacacaagcttccgttcggagtcgtcgtcgttgacgaagcatcaatg
ctttctctgcctctggccgctagcctcctctctgcaatcgggcctcaaactcgtctaatt
ctcgtcggggacccagggcagcttgtctcggtggacgccggtagtgtcctggccgacatc
gtttcgtcggctgatgccctccaagcgcagcttcctgtcacgatcctcacctgtaaccac
cgctcgagaggagatatcgcacggctgtcggaggcggtacgcgagggagacaagagcact
gcgttggacgtattggcgacagctgctggcgtgacacatgactctccttcccccgatagc
atcgcgacgatcagtggtcgtcgcagtattacgtggatcgacgctgacccggcgagtatc
accatggccgaccttccggcggtcgcggaggtgatcgcacgcaccggggcaagaatgctt
gagcttgctcaggctagtgccgacgctgctgctctcaaactcgtcgatgcccaccggttg
ttgtgcgctcaccgagaggggccatacggggtagacgagtggtctcagcgcatggttact
gtactttcagatgtgttgcctggtgttggccaaggccggtgggttctcggcgaaactgca
atagtaacgcataacctcgcacaattgggagtcaataacggcgattgcggggtcatcgtt
gaaacaaggcccgtccccacgatagctctaccgggacccggtggagtccccagacggttg
ccctgttccctcatcccatcgctgcaacccttacaggcgatgacgattcacaaagcgcag
ggcagccaattcacggacgtaacggtggtcctgccaccacccgactcgcccctcctctct
cgtgagttgctctataccgccatcacgcgtgcacgtgaacacctcactgtggtgggcaca
agggagtctgtggagagggcgattgaccgggctaatgatcgacgttctgggattcagcgc
cggtgggaagaaagtcgcacttcctga

DBGET integrated database retrieval system