KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_08080Help
Entry
TIA2EST22_08080   CDS       T01654                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pav00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pav00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1744903..1745937
Genome map
AA seq 344 aa AA seqDB search
MNPRAVEIAKKLSPEQRAGQCILVGVVPSDSPEYITNLIDTQCLAGIFLLGHWTSRSKLE
AMLSAVNHVSPQGIKPIVATDHEGGEIQNIRVPGVDHLPSQEALARMSPAKVQAVVTTGA
RQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRKAGI
ISTTKHFPGIGRITEDTDFKSAGITDDKTTRHDRYLESFRMAFDAGSEAVMIASAYYSKI
DPGTLGLFSSKIMTDMLRGDFGYQGLIVSDDLGSSVSVFSVDGGHRASKFVSAGGDLAIT
ADPLLAGPMIRALTSTATSASGKKRLVDAASHVINVKLAHSLTK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcgagctgtcgaaatcgccaagaaattgtctcccgagcaacgcgccggccaa
tgcattcttgtcggcgtagtgccatcagactcccccgaatacatcaccaacctcattgac
acccagtgcttagccggaatcttcctgctaggacactggacgagcaggtccaagcttgag
gccatgctcagcgctgttaatcacgtcagcccgcagggcatcaaacctattgtcgcaact
gaccacgaaggtggcgaaatccagaacatccgggtgccaggagtcgatcacctgccgagt
caggaagctctggcccggatgtccccggccaaggtgcaagcagtcgtaacgaccggtgct
cgtcaactcgccaaactcggcgtccatatggtcttctcccccgtggctggcgtcatcgac
cctcgccttggggtacgtaataagccaattgccaagcatcatcgtggtttcggaaccgat
ccgcacctctgcgggcaatactcggcagccgtcgttgcgggacaccgcaaagcggggatc
atttcgaccactaagcattttcctggcatcggacggatcacggaggatactgacttcaaa
tccgccgggattactgacgacaagaccacccgccacgaccgatatcttgagtctttccgg
atggcctttgacgctggatctgaagccgtcatgatcgcatccgcgtactactcaaagatc
gatcccggcaccctcgggttattttcatcaaagattatgacagatatgctgcgcggagac
ttcggttatcagggactcatcgtgtccgacgacctggggagttcagtctcagtattctca
gtcgatggtggtcatcgggcaagcaaattcgtctctgccggcggcgatctagctatcaca
gctgacccccttctggcaggccccatgattcgcgcgttgacgtcgaccgcgacgtccgcg
tccggtaagaagcgtcttgttgacgctgctagccatgtcatcaatgtcaaattggcgcat
tcattgacgaagtga

DBGET integrated database retrieval system