KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_08080Help
Entry
TIA2EST22_08080   CDS       T01654                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TIA2EST22_08080
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TIA2EST22_08080
Enzymes [BR:pav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TIA2EST22_08080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1744903..1745937
Genome map
AA seq 344 aa AA seqDB search
MNPRAVEIAKKLSPEQRAGQCILVGVVPSDSPEYITNLIDTQCLAGIFLLGHWTSRSKLE
AMLSAVNHVSPQGIKPIVATDHEGGEIQNIRVPGVDHLPSQEALARMSPAKVQAVVTTGA
RQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRKAGI
ISTTKHFPGIGRITEDTDFKSAGITDDKTTRHDRYLESFRMAFDAGSEAVMIASAYYSKI
DPGTLGLFSSKIMTDMLRGDFGYQGLIVSDDLGSSVSVFSVDGGHRASKFVSAGGDLAIT
ADPLLAGPMIRALTSTATSASGKKRLVDAASHVINVKLAHSLTK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcgagctgtcgaaatcgccaagaaattgtctcccgagcaacgcgccggccaa
tgcattcttgtcggcgtagtgccatcagactcccccgaatacatcaccaacctcattgac
acccagtgcttagccggaatcttcctgctaggacactggacgagcaggtccaagcttgag
gccatgctcagcgctgttaatcacgtcagcccgcagggcatcaaacctattgtcgcaact
gaccacgaaggtggcgaaatccagaacatccgggtgccaggagtcgatcacctgccgagt
caggaagctctggcccggatgtccccggccaaggtgcaagcagtcgtaacgaccggtgct
cgtcaactcgccaaactcggcgtccatatggtcttctcccccgtggctggcgtcatcgac
cctcgccttggggtacgtaataagccaattgccaagcatcatcgtggtttcggaaccgat
ccgcacctctgcgggcaatactcggcagccgtcgttgcgggacaccgcaaagcggggatc
atttcgaccactaagcattttcctggcatcggacggatcacggaggatactgacttcaaa
tccgccgggattactgacgacaagaccacccgccacgaccgatatcttgagtctttccgg
atggcctttgacgctggatctgaagccgtcatgatcgcatccgcgtactactcaaagatc
gatcccggcaccctcgggttattttcatcaaagattatgacagatatgctgcgcggagac
ttcggttatcagggactcatcgtgtccgacgacctggggagttcagtctcagtattctca
gtcgatggtggtcatcgggcaagcaaattcgtctctgccggcggcgatctagctatcaca
gctgacccccttctggcaggccccatgattcgcgcgttgacgtcgaccgcgacgtccgcg
tccggtaagaagcgtcttgttgacgctgctagccatgtcatcaatgtcaaattggcgcat
tcattgacgaagtga

DBGET integrated database retrieval system