KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_09285Help
Entry
TIA2EST22_09285   CDS       T01654                                 

Definition
enoyl-CoA hydratase/isomerase family protein
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TIA2EST22_09285
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TIA2EST22_09285
   00650 Butanoate metabolism
    TIA2EST22_09285
  Lipid metabolism
   00071 Fatty acid degradation
    TIA2EST22_09285
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TIA2EST22_09285
   00310 Lysine degradation
    TIA2EST22_09285
   00360 Phenylalanine metabolism
    TIA2EST22_09285
   00380 Tryptophan metabolism
    TIA2EST22_09285
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TIA2EST22_09285
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TIA2EST22_09285
   00281 Geraniol degradation
    TIA2EST22_09285
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TIA2EST22_09285
   00627 Aminobenzoate degradation
    TIA2EST22_09285
   00930 Caprolactam degradation
    TIA2EST22_09285
Enzymes [BR:pav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TIA2EST22_09285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2010519..2011454)
Genome map
AA seq 311 aa AA seqDB search
MDEVKISGTDDVTIILDRPRAINSLSGEMLGAIGEAVKGSPRSIDLSGAGERGYCSGADI
RELRSLVLKDPEAAGDWLDGEYDVDAAIAEVHSGTAHLHGISMGGGLGLALRLKRVEARD
DLVLAMPETGIGLWPDVGACFELSRAPRLVGRHIAMTGAFIDAASALWAGLVDEVVDADG
EPVDVDPVACQLARDAVWIQECYDTDDPVEVCRRLADRPEPAARKTAEHIATRCPLSVAV
ALAAVVRAESASGLGEVLETDRALGRSFMRNSDFCEGVRAQLVDKDRNPHWSHESVADVP
ARQVEGMFDPS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtgaagatcagcggtaccgacgatgtcacgatcatcttggaccgtccccga
gcgatcaactcgttatctggtgagatgctgggggctattggggaggccgtcaagggatcg
ccgcgcagcatcgatctatccggtgcgggagagcgcggctactgttcgggagctgacatt
cgcgagctcagatcgttggtattaaaggatcccgaggccgctggtgactggttggatggt
gagtacgacgttgacgctgccattgctgaggtgcattcggggaccgcgcatctgcatggc
atttccatgggcggcgggcttgggttggcactgcgccttaagcgggtcgaggctcgcgac
gacctcgtccttgcgatgccggaaacgggtattggtctatggcctgacgtgggtgcgtgt
ttcgagctctctcgggccccgcgccttgtcggccgccatatagccatgaccggggccttc
atcgatgcggcttcggcgctgtgggccggtttggtagatgaggtcgtcgacgccgacggc
gagcccgttgacgtcgatccggtcgcttgtcagttggcgcgcgatgcggtgtggattcag
gagtgttatgacactgatgatcccgtcgaggtgtgtcgtcgattggctgatcgtcccgag
ccggccgcgcgtaagacggctgagcacatcgcgacgcgctgtccgttgtcggtagctgtc
gcattggccgctgtcgtgagggctgaatccgcgtcaggtcttggcgaggtgttggagact
gatcgtgctctggggcggtcctttatgcgcaattcggacttttgtgagggggtgcgcgcc
cagctggtcgacaaggaccgcaacccgcattggtcccacgagagcgtggctgacgtgccc
gctcgtcaggttgaggggatgttcgacccgtcctga

DBGET integrated database retrieval system