KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_09285Help
Entry
TIA2EST22_09285   CDS       T01654                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00071  Fatty acid degradation
pav00280  Valine, leucine and isoleucine degradation
pav00310  Lysine degradation
pav00360  Phenylalanine metabolism
pav00380  Tryptophan metabolism
pav00410  beta-Alanine metabolism
pav00640  Propanoate metabolism
pav00650  Butanoate metabolism
pav00903  Limonene and pinene degradation
pav01100  Metabolic pathways
pav01110  Biosynthesis of secondary metabolites
pav01120  Microbial metabolism in diverse environments
pav01130  Biosynthesis of antibiotics
pav01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TIA2EST22_09285
   00650 Butanoate metabolism
    TIA2EST22_09285
  Lipid metabolism
   00071 Fatty acid degradation
    TIA2EST22_09285
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TIA2EST22_09285
   00310 Lysine degradation
    TIA2EST22_09285
   00360 Phenylalanine metabolism
    TIA2EST22_09285
   00380 Tryptophan metabolism
    TIA2EST22_09285
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TIA2EST22_09285
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TIA2EST22_09285
   00281 Geraniol degradation
    TIA2EST22_09285
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TIA2EST22_09285
   00627 Aminobenzoate degradation
    TIA2EST22_09285
   00930 Caprolactam degradation
    TIA2EST22_09285
Enzymes [BR:pav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TIA2EST22_09285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: AEW82157
Position
complement(2010519..2011454)
Genome map
AA seq 311 aa AA seqDB search
MDEVKISGTDDVTIILDRPRAINSLSGEMLGAIGEAVKGSPRSIDLSGAGERGYCSGADI
RELRSLVLKDPEAAGDWLDGEYDVDAAIAEVHSGTAHLHGISMGGGLGLALRLKRVEARD
DLVLAMPETGIGLWPDVGACFELSRAPRLVGRHIAMTGAFIDAASALWAGLVDEVVDADG
EPVDVDPVACQLARDAVWIQECYDTDDPVEVCRRLADRPEPAARKTAEHIATRCPLSVAV
ALAAVVRAESASGLGEVLETDRALGRSFMRNSDFCEGVRAQLVDKDRNPHWSHESVADVP
ARQVEGMFDPS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtgaagatcagcggtaccgacgatgtcacgatcatcttggaccgtccccga
gcgatcaactcgttatctggtgagatgctgggggctattggggaggccgtcaagggatcg
ccgcgcagcatcgatctatccggtgcgggagagcgcggctactgttcgggagctgacatt
cgcgagctcagatcgttggtattaaaggatcccgaggccgctggtgactggttggatggt
gagtacgacgttgacgctgccattgctgaggtgcattcggggaccgcgcatctgcatggc
atttccatgggcggcgggcttgggttggcactgcgccttaagcgggtcgaggctcgcgac
gacctcgtccttgcgatgccggaaacgggtattggtctatggcctgacgtgggtgcgtgt
ttcgagctctctcgggccccgcgccttgtcggccgccatatagccatgaccggggccttc
atcgatgcggcttcggcgctgtgggccggtttggtagatgaggtcgtcgacgccgacggc
gagcccgttgacgtcgatccggtcgcttgtcagttggcgcgcgatgcggtgtggattcag
gagtgttatgacactgatgatcccgtcgaggtgtgtcgtcgattggctgatcgtcccgag
ccggccgcgcgtaagacggctgagcacatcgcgacgcgctgtccgttgtcggtagctgtc
gcattggccgctgtcgtgagggctgaatccgcgtcaggtcttggcgaggtgttggagact
gatcgtgctctggggcggtcctttatgcgcaattcggacttttgtgagggggtgcgcgcc
cagctggtcgacaaggaccgcaacccgcattggtcccacgagagcgtggctgacgtgccc
gctcgtcaggttgaggggatgttcgacccgtcctga

DBGET integrated database retrieval system