KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_10350Help
Entry
TIA2EST22_10350   CDS       T01654                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00010  Glycolysis / Gluconeogenesis
pav00520  Amino sugar and nucleotide sugar metabolism
pav01100  Metabolic pathways
pav01110  Biosynthesis of secondary metabolites
pav01120  Microbial metabolism in diverse environments
pav01130  Biosynthesis of antibiotics
pav01200  Carbon metabolism
Module
pav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pav_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST22_10350
   00520 Amino sugar and nucleotide sugar metabolism
    TIA2EST22_10350
Enzymes [BR:pav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     TIA2EST22_10350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK bPH_2
Motif
Other DBs
NCBI-ProteinID: AEW82356
Position
2236860..2237942
Genome map
AA seq 360 aa AA seqDB search
MFTWTVSVVPHARSQSVRLSQGPIQRKLGLADIDVHTSSGPVTVSCPHLDAMDAQVFAVG
QMDPPVPPVAGNCHPSLPRTNHLPLRLSTMNKVLGIDVGGSGIKGAPVDLEVGDFAEPRL
RIPTPEKSSPENIVTVLREIVDNFAPTIGDGPVGISFPAPARHGVIPFIANLDQGWAGLH
AEKYISDALGRPVTVLNDADAAGVGEVHYGAARGVPGVVVLTTLGTGIGSAVINNGILLP
NTELGHLEIDGHDAEKRAASSVKDRKHMSYKDWATKRLQRYYDVVEMLFSPDLFVVGGGI
SKDHKKFFKYLELETPMVPAQLLNRAGIIGAAWQAQWRLEHPDATEEEVVKAAKKAKDAD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgtttacctggaccgtcagcgtcgttcctcatgctcggtcgcagtcggtaagactgtcc
caggggccgatacaacgcaaactcggcttggctgatatcgacgtgcatacctcgtctggc
ccagtgacggtttcctgtccccacctcgacgccatggacgcccaggtcttcgccgtcggt
cagatggatccgcccgtgccgcccgtggccgggaactgtcacccgagtctcccccgcacc
aaccatctaccgttacgcttgtccaccatgaacaaggtgctgggaattgacgttggtggt
tccgggatcaagggagccccggttgacctcgaggtcggagactttgccgaaccgaggctt
cgcattcccaccccggagaagtcgtcccccgagaacatcgttaccgtgctgcgtgagatc
gtcgacaatttcgcccccaccatcggtgacgggccggttggcatctctttccccgccccg
gcacgccacggcgtcattcccttcatcgctaacctcgatcagggttgggccggcctgcac
gccgagaaatatattagtgacgctctcggccgcccagtgaccgttcttaacgacgccgac
gccgcaggtgtgggcgaggtccactacggcgctgcgaggggagtacctggcgttgtcgtt
ctcaccactctgggcaccggcatcggctctgccgtcatcaataacggcatcctgctgccg
aacaccgagcttgggcacctcgagattgatggtcacgacgccgagaagcgcgctgcctcc
tcggttaaggatcgcaagcacatgtcttacaaggactgggcaaccaagcgtctgcagcgt
tactacgacgtcgtcgagatgctcttttcccccgatctctttgtcgtcggtggcggtatc
tctaaggaccataagaagttcttcaagtacctcgagctcgagacgccgatggtgcccgcc
cagttgttgaatcgagctggcatcatcggtgcggcctggcaggcccagtggcgtctagag
catcctgacgccaccgaggaagaggtcgtcaaagctgccaagaaggcgaaggacgctgac
tga

DBGET integrated database retrieval system