KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_11105Help
Entry
TIA2EST22_11105   CDS       T01654                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST22_11105
   01230 Biosynthesis of amino acids
    TIA2EST22_11105
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST22_11105
   00030 Pentose phosphate pathway
    TIA2EST22_11105
   00051 Fructose and mannose metabolism
    TIA2EST22_11105
   00052 Galactose metabolism
    TIA2EST22_11105
  Energy metabolism
   00680 Methane metabolism
    TIA2EST22_11105
Enzymes [BR:pav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIA2EST22_11105
Protein phosphatases and associated proteins [BR:pav01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TIA2EST22_11105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2390842..2393106
Genome map
AA seq 754 aa AA seqDB search
MHVDDEMRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQG
MIDGGDGIRRFGWDDVGSILNRGGTVIGTFRCKGMRERPGRLKAVRNLLEHGIDRLVVIG
GDGSLTGLDVLRTEWTDLVAELVDTGQVSAEVAREHPALMIAGLVGSIDNDLVGSDMTIG
ADTALHRIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPED
GWEDRMCAELKRGRQAGRRDSIVVVAEGATDRSGNRISSEYVRQVLEDKLGEDARVTILG
HVQRGGRPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGSNRIHRLPLVKAVADTKS
VPGLITEGRYNEAMRMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRVAIMHAGGPAP
GMNTAARAAVRLAISRGHTVVGIHNGFIGLATGDMSELAWSDVEGWAGEGGAELGTRREI
PSTRDLYAVSRALEDHHIGALLVIGGYSAYEGIYTMMTERDRYPAFRIPTVCIPASIDNN
LPGSELSIGTDTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERI
YTNEDGISLDDLANDVHWLRESFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYD
VRQVVLGHMQQGGSPSPFDRLLANRLGYRALNLIDDELAAHQDGSWFIGVNESGMRPCSM
DTMPSLIDAAHRRPREQWWLQLRTIARMVSDEVR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgttgatgacgagatgaggctcacccccactctccccgacggtcatggtctgcgc
attggcatcctgaccagcggtggcgacgctcagggcatgaacgctgctgtgcgggctgtg
gtgcgctctgcgctaagtgtgggagccgaggtctatgcgatatacgagggctaccaggga
atgatcgatggtggcgatggcatccgtaggttcgggtgggacgacgtcggctcgatcctc
aaccgtggcggcaccgtgatcggaaccttccgttgcaaggggatgcgcgaacgtccgggg
cgcctgaaggctgtcagaaatctcctcgaacacgggatcgatcgtctcgtcgtcatcggc
ggtgacggttcgctcaccggcctggatgtgctgcgcaccgaatggacagacctggtcgct
gaactcgtcgacaccggccaggtgagcgccgaggtagcccgggaacaccccgccctcatg
atcgccgggctcgtcggatccatcgacaatgacctcgtcggatccgatatgaccatcggt
gccgatactgctctgcaccgtattgtcgatgccatcgacgacctcgcctccaccgcggcc
agccaccagcgatccttcgtcgttgaggtgatgggccgccactgcggctatctcgccctt
atggcagcagttgccggcggagctgactatgttcttattccggaacggccgcccgaggac
ggttgggaggaccgcatgtgcgccgagctcaaacgtggccgtcaggcgggccgacgcgac
tcgatcgtcgtcgtcgcggagggcgccaccgatcgttccgggaaccggatctcctcggag
tacgtccgccaggtgcttgaggacaaactcggtgaggacgcccgggttaccatcctgggc
cacgtccagcgcggcggacgaccgtcagcctatgaccgctgggcgtcgacctggttgggt
tatcacgcggttcacgaggtgctctcgaccactccagaggccgaggggcgcgttatcggc
actgggtccaaccgcatacatcgcctccccctggtcaaggccgtcgctgacacgaagtcg
gtgcccggtctcattacggagggccgttacaacgaggccatgcggatgaggggacgttcc
tttgtcgagatggacgcgatcttcaccgaactcagtgaaccagctcgtaccacttccgac
accgctggtgacgccgaccgcaagcgcgtcgcgatcatgcacgctggcggtccggccccg
ggcatgaatactgctgcccgtgctgcagtgcgactggcgatttcccgcggtcataccgtt
gtgggaatccataacgggttcatcggactagcgaccggggacatgtcggaattggcctgg
agcgacgtcgagggctgggccggggaaggcggcgctgagctgggtacccgccgcgagatc
cctagcactcgcgacctttatgctgtcagccgcgctctggaggatcatcacatcggcgcg
ttgctcgtcattggtggctactcggcctacgaaggtatctacaccatgatgactgagcgg
gaccggtacccggctttccgtattccgacggtgtgcattccggcttcgatcgacaacaac
ctccccggttcggaactgtccatcggcaccgacaccgctctcaacgtcattgtcgaggcg
atggacaagattaaagagtcgggtatcgcgtccagacgctgcttcgtcgtcgagacgatg
ggtcgtgactgcggatacctcgcgctgatgtcgggtatcgcagctggcgctgagcggatc
tataccaacgaggacggcatctccctggacgatctagccaacgacgtccattggttgcgg
gagtcattcgcccacggacgacgacttttccttgccgtgcgcaacgagaacgcatcgcac
aattacaccaccgacttcatcgcgcggctgctggaggaggaatcacacggcatgtatgac
gtacgccaggtggtactagggcatatgcagcaaggcggctcaccctcacctttcgaccgc
ttgctcgccaaccgactcgggtatcgcgctctcaatctcattgacgacgagttggcggcg
catcaggacggttcatggttcattggcgtcaacgagtcgggcatgcggccctgttcgatg
gacaccatgccctctctcattgacgccgctcatcgtcgtccccgcgaacagtggtggctg
caactgaggactattgccaggatggtctcggacgaggtgcggtaa

DBGET integrated database retrieval system