KEGG   Prunus avium (sweet cherry): 110753678Help
Entry
110753678         CDS       T05161                                 

Definition
(RefSeq) acid beta-fructofuranosidase 2, vacuolar-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110753678
   00500 Starch and sucrose metabolism
    110753678
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110753678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 685 aa AA seqDB search
MADPRPFLPSDPNTLPCTYTPLPNGANPDGAPETRKRHLKELLAIFSGLLMVSLLVVIIS
GKEPNSHNASNKHEPLFLAKQPHTASPQKLRPVSRGVPAGVSEKMNRLAGDVEAPVFPWN
NSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNKAVWGDIVWGHAVSKDLI
HWLHLPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPADHSDPL
LLNWVKYSGNPVLVPPPGIGYKDFRDPTTAWFTSQGKWRITIGSKLNKTGISLVYDTKDF
KTYELLNGVLHAVPGTGMWECVDFYPVSKTSDKGLDTSVNGPDVKHVVKASLDDDRNDYY
AFGTYDEKTGKWVPDNQKIDVGIGIRYDYGKFYASKTFYDQNKGRRVLWGWIGESDSENA
DVQKGWASLQGIPRTVLFDQKTGSNLLQWPVEEIETLRLSSKDFNKVEVKAGSVVPLQVG
PATQLDIVAEFELDKKVLESVAESNEAFSCNTSGGAAKRGALGPFGLLVLADESLTEQTP
VYFYVAKGPGGIVDTFFCADQTRSSVANDVRKEITGSYIPVLKDEKLSVRILVDHSIVES
FAQGGRTTITNRIYPTKAIYGAARLFVFNNATETSVTASIKVWQLNSAFIRPYYQDETSL
ASFNHVTFIKLIAPFFIFFTLFFVR
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccaagaccttttcttccatcagatcccaataccctgccctgcacctacacc
cctctgccaaatggagccaacccggatggagccccggagacccggaagaggcacttgaag
gagctcctagcaatcttttctgggttgcttatggtttctctgttggtggtcattataagt
ggcaaggaaccaaattcccataatgcaagcaacaaacatgagcccttgtttttggctaaa
caacctcatacagcaagcccccagaaattgaggccggtttctcggggcgtgccggccgga
gtgtctgagaagatgaaccggttagccggggacgtggaagcgccggtgtttccatggaac
aatagcatgttgtcatggcagagaactgccttccattttcagcctgaaaagaattggatg
aatgatcccaacggtccattattttacaagggttggtaccatttcttctaccagtacaat
cccaacaaagcagtatggggagacatagtttggggccatgctgtgtccaaggacttgatc
cattggcttcaccttcctctggccatggtggctgatcagtggtatgacatcaatggcgtt
tggactggctcagccaccattctccctgatggtaaaattgtcatgctctacactggttca
accaatgagtctgtccaggtccaaaaccttgcatatcctgctgatcactctgaccctctc
ctcctcaactgggtcaagtactcaggcaacccggtcttagtcccacccccgggcatcggg
tacaaggacttccgggaccctaccacggcatggttcacgtcacagggcaaatggcggatc
accattgggtccaagcttaacaaaactgggatatctttggtttatgacactaaggacttc
aaaacctatgagcttctgaatggggtgcttcatgctgtccctgggactggaatgtgggag
tgtgtggatttttatccagtgtcgaaaaccagtgacaagggattggatacttctgtgaac
gggcctgatgtgaagcatgtggtcaaggctagccttgatgatgataggaatgattactat
gcgttcgggacttatgatgagaagactggcaaatgggttcctgataaccaaaagattgat
gttggtattggaattaggtatgattatggcaaattctatgcctccaagactttctatgac
caaaacaagggaaggagagtgttgtggggttggattggagagtctgatagtgaaaatgct
gatgtccaaaagggatgggcctctcttcagggaattccaagaacagttttgtttgaccag
aagactggaagtaacctacttcaatggccggtggaggagattgagacgttgagattgagc
agcaaggatttcaacaaggtagaggtcaaggcagggtctgtggtgccacttcaagttggc
ccagccacacagttggacattgttgctgagtttgagttggacaagaaggttttagagagc
gtagctgaatcgaatgaagccttcagttgcaataccagcggcggggctgccaaacgcggt
gctttgggaccctttggtcttcttgttcttgcagatgagagcctcacagagcagactcct
gtctacttctatgttgccaaaggacctggtggcattgtcgacactttcttctgtgctgat
caaacaaggtcttctgtggcaaatgatgttcgtaaagaaattactggtagctatattcca
gtactaaaggatgagaaattatcagtgaggatactggttgaccattcgattgtggaaagc
tttgctcaaggtggaagaacaaccatcacaaatcggatttacccaaccaaggcaatttat
ggggctgctaggctatttgtgttcaacaacgccacagagaccagtgttacagcatccatc
aaagtatggcagttgaactctgctttcatacgcccatactaccaggacgaaaccagcctc
gcaagcttcaaccatgttacatttatcaaattgattgccccattcttcattttttttact
ttattttttgttagatag

DBGET integrated database retrieval system