KEGG   Propionibacterium acnes 266: PAZ_c00680Help
Entry
PAZ_c00680        CDS       T01971                                 

Gene name
nahA
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
paw  Propionibacterium acnes 266
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAZ_c00680 (nahA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PAZ_c00680 (nahA)
Enzymes [BR:paw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAZ_c00680 (nahA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(67583..69121)
Genome map
AA seq 512 aa AA seqDB search
MPTNDTLIRGLCPQPRQVQLTEGQFPLPSVLTWTGPDEVINAVTILTERLAPALDVVRAT
SHTDDASLTVIVDPALEAEGYRIDIDAQVRITVGSPSGARWAVQTLLQLLTPWVYGPGPL
ALKHLCLPKGVIVDAPHHSWRGAHLDVSRHFMPTSFIMNFLDVLAVHKLNRLHLHLTDDQ
GWRLPVPGWPRLTTVGAWRPGTVRGHQPPPDDNGCDDVAEHDHIPHGGAYTVDQLRAIDE
RAQLLGITVVPEVDLPGHTESVVAAYPELGCGAPISHPRTAFGVSEHHINLTDAALGFCR
DVLDAVMEIFPNSPIHIGGDECPGKEWFGHKPTRTRLAELGITTPHQAQAWFERQICGHV
VAAGRQVIAWDEVLEAGAPEEVTVMVWRDADDIARAAAAGHDVIAAPARHTYLDHGMETG
PQAPVTIDAPMTMNDVAGLHDVLAAVNSPHLLGGQFQLWTEYLCTPAQVEDAAFPRGTSI
AEQLWTGNPARPLSELEAQTRRLTAMGVNWHR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaacgacaccctcatccggggcttgtgcccccagccccgccaggtacaactc
accgaaggacaattccccctgccgtcggtgctcacctggactggccccgacgaggtcatc
aacgccgttacgatcctcaccgagcgactggctccagcactcgacgtcgtgcgagcaaca
tcacacaccgacgatgcctccctcaccgtcatagtggatcccgctttagaagcggagggc
tatcgcattgacatcgacgcgcaggtccgcatcactgtcggcagtccatctggagcgcgt
tgggcagtgcaaaccctgctccagctgctcaccccgtgggtttacgggcccggaccgcta
gcgctgaagcacctatgccttccgaaaggcgtcatcgtcgatgcgccacaccacagttgg
cgcggggcccatctagacgtttcgcggcatttcatgcccacctcgttcatcatgaacttt
ttggacgtgctggccgtacacaagctcaatcggctgcacctacatctcactgacgatcag
gggtggcgtctgccggtaccgggctggccgcggctgaccacggtgggcgcgtggcgtcca
ggaacggtacgagggcaccaaccgccacccgacgacaacggctgtgacgacgtcgctgag
cacgaccacataccccacggtggtgcctacaccgtcgaccagctgcgcgccatcgacgag
cgagctcagctgttgggcatcacggtcgtcccggaagtcgatcttccgggacacaccgag
tcggtggtggccgcctaccccgagttgggctgtggagcaccgatcagccatccgcgcacc
gccttcggggtgtcggagcaccacatcaacctcaccgatgctgcgctgggtttttgccgc
gacgtcctggatgccgtgatggagatcttcccgaactcgccgatccacatcggcggcgac
gagtgccccggcaaggagtggtttggacataagcccacccgcacccggctagccgagctg
ggcatcacgaccccacaccaggctcaggcgtggttcgagcgccagatctgtggccacgtc
gtcgctgctggacgtcaggtcatcgcctgggacgaggtgttggaagccggtgcgcccgag
gaggtcaccgtgatggtgtggcgggatgccgacgacatcgcccgcgctgctgccgcaggt
cacgatgtcattgccgcacccgcccggcatacctacttagatcacggcatggagacgggc
ccgcaggcaccggtgacaatcgacgccccgatgactatgaacgatgtcgccgggctgcac
gacgtgctggccgcggtgaactcaccccacctgctgggtggacagttccagttgtggacc
gaatatctgtgcacccctgctcaggtcgaggatgccgccttcccgcgcggcacgtcgatc
gccgaacagttgtggactggcaacccggctcgaccgctgtcggaattagaggcccaaact
cgccgtctcaccgcgatgggggtcaattggcaccgataa

DBGET integrated database retrieval system