KEGG   Propionibacterium acnes 266: PAZ_c00970Help
Entry
PAZ_c00970        CDS       T01971                                 

Gene name
pfkA1
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
paw  Propionibacterium acnes 266
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAZ_c00970 (pfkA1)
   01230 Biosynthesis of amino acids
    PAZ_c00970 (pfkA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAZ_c00970 (pfkA1)
   00030 Pentose phosphate pathway
    PAZ_c00970 (pfkA1)
   00051 Fructose and mannose metabolism
    PAZ_c00970 (pfkA1)
   00052 Galactose metabolism
    PAZ_c00970 (pfkA1)
  Energy metabolism
   00680 Methane metabolism
    PAZ_c00970 (pfkA1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PAZ_c00970 (pfkA1)
Enzymes [BR:paw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAZ_c00970 (pfkA1)
Protein phosphatases and associated proteins [BR:paw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAZ_c00970 (pfkA1)
Messenger RNA biogenesis [BR:paw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PAZ_c00970 (pfkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
102671..103879
Genome map
AA seq 402 aa AA seqDB search
MIATMDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPGLNAAIRGFGKAAIRQ
HDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRDKVNHMIIDGEERDMVP
TIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTIDNDIVGTDDSFGFSTAL
EIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGGADVILLPEVPYKLDSIVQ
AVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASKTSETKAAAKKAKKDLEHSM
RDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLLATRLGTVGAKLVDDGEFGIM
VAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTGLGD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgattgccacaatggaccgcagtgttgtcggtgccatccatggaaggatgggtaccacc
cgacacagatcaggagtcgtcatgtccaaaaagaagaaggtcggcatcctcaccgcaggc
ggtgattgccccgggctcaacgccgctatccgcggatttggcaaggctgccatccgccag
cacgacatggagctcatcggtattcaggacggctttcttggattggcagggaaccgcacc
atctcccttgacccgcgtgccctctcaggcatcttgacggtcggcgggaccatcctggga
actagccgtgacaaggtcaatcacatgattatcgacggcgaggaacgggatatggtcccc
accatcgtcgagaattacgagaagctgggacttgacgctttggtgactttgggtggcggt
ggcaccgccaagaacgcgtacaagctcgctaaggccggactgaacgtcctgcatctgccc
aagacgattgacaacgacatcgtcggaaccgacgactccttcgggttctcgacagcactg
gagattgccacggaggccatcgaccggctgcactccaccgcccattcccaccaccgcatc
atcctcgctgagatcatgggccaccgtgccggctggctggccctcggctcgggcatcgct
ggtggcgctgacgtcatcctgctgcccgaggtgccctacaagctggactccatcgtccag
gcggtggaaaaccggcaaaagcaggggttgaatttctcggtcatcgcggtggctgaggga
gctcgcgatgaggctgattcggccgcgatggctggagctcaggccctcgttgacgcttcc
aagacctccgagacaaaggcggctgccaagaaggccaagaaggaccttgagcattccatg
cgtgacaacaccctcaaattggctactcagcttgaggaggccaccgggctggaatcgcga
gtctcgatcctcggctatgtgcagcgcggtggtatcccgtgcgcccacgaccgtctgctc
gcgacccggctgggaaccgtgggtgccaagctcgttgacgacggcgagttcggcatcatg
gtcgccgctcagggcggagacgccacgaccgttccgttgaaagatgtcgctggcaaggtt
aaatacgtacctgccgaccacccatgggttaaggcggcccgtcaggtcggaaccggtcta
ggcgactga

DBGET integrated database retrieval system