KEGG   Propionibacterium acnes 266: PAZ_c01080Help
Entry
PAZ_c01080        CDS       T01971                                 

Definition
magnesium-chelatase subunit ChlI-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
paw  Propionibacterium acnes 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:paw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(117084..118070)
Genome map
AA seq 328 aa AA seqDB search
MAQRPVYPFCAIVGQEEMKLALILATISPDLSGVLIRGEKGTAKSTAVRGLAALLPQHRE
IPGPYHLSPDEYPTHAVALNLPEVMPEPRTVQVPVVELPVGVTEDRVTGTLDMETALREG
RRRFEPGLLAAAHRAILYVDEVNLLDDHVVDLLLDSAAMGVNTVEREGVSVTHPARFTLV
GTMNPEEGELRPQLLDRFGLCVTVSGEDDPDKRTEVIRRRMAFEDDPGGFSRTWEQDGHK
LSERIQRATELVTQVVISDETLTTAARTCINAHVDGHRADIMMVRAARTLAAWNGCTEIT
TEALSQAARLVLPHRMRRQPLESVGRAV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgccccgtctatcccttctgcgccatcgtcggtcaggaggagatgaagctg
gctctcatcctcgctaccatcagccccgatttgtccggggtacttatccgcggcgagaaa
ggcaccgccaagtccaccgcggtgcgcggactagcagccctactgccgcaacaccgggag
attcccgggccctaccacctgtcccccgacgagtacccgacccacgcggtcgcactcaac
ctgcctgaggtcatgcccgagcctcgcaccgtgcaggtgccggtcgtcgagctgccggtg
ggagtcactgaggatcgcgtcaccggcactctcgacatggagacagccctgcgggagggg
cgacgccgtttcgagccgggtctgctagcagccgcgcaccgggcgatcctctacgtcgac
gaggtcaacctcctcgacgaccacgtcgttgacctgctgctggactcagccgccatgggc
gtcaacaccgtagagcgagagggggtcagcgtcacccatccagcccggttcaccctggtc
ggcaccatgaatccggaggagggcgaactgcgcccccagttgctcgaccgcttcgggctg
tgcgtcaccgtcagcggggaggacgacccggacaagcgcaccgaggtaatccggcgccga
atggcctttgaggacgaccctggtggcttctcacgcacatgggaacaggatggccacaag
ctcagcgaacggatccaacgtgctactgagctcgtcacccaggtagtcatctccgacgaa
actctcacgacggcggctcgtacctgcatcaacgcacacgtcgacggtcaccgcgccgac
atcatgatggtccgggcggcgcgcactctggcagcctggaacggttgcaccgagatcacc
acagaggccctctctcaagctgcccggctcgtcctgccgcaccggatgagacgacaacca
ctcgagtcagttggtagggcagtgtga

DBGET integrated database retrieval system