KEGG   Propionibacterium acnes 266: PAZ_c02250Help
Entry
PAZ_c02250        CDS       T01971                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
paw  Propionibacterium acnes 266
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:paw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PAZ_c02250 (recR)
DNA repair and recombination proteins [BR:paw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PAZ_c02250 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256194..256799
Genome map
AA seq 201 aa AA seqDB search
MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADALREVKEKAKFCKICF
NVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYHVLGGAISPLDGKGPAD
LHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMGVTVSRLASGLPVGGDLE
YADEVTLGRAFEGRLHVGVGA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacggtccgctgcaagaactcattgacgccctttctcggctaccggggatcggg
ccgaagggtgcgcagcggatcgcttttcatatcctcgacgctcctgcggaggaggccaat
gaactggccgacgccttgcgcgaggtcaaagagaaggccaagttctgcaagatttgtttt
aatgtctcctccgacgaggtgtgccagtactgccgtgatccgcgtcgggaccagtcgatg
atctgtgttgttgaggagtccaaagacgttattgctgtggagcgtacccgacaattccgt
ggtctgtatcacgttcttggcggagcgatctcgccgttagacggaaaaggcccagctgat
ctccacatccgtgaattgtgccagcggttggctgacgaaaccgttaccgaggtgatcctg
gccaccaacccgaaccttgagggggaagcaacggcaacgtatctttcccgcctcatcgcg
cccatgggcgtgacggtgtcccgactagcctctggtttgccggttggcggcgacctggaa
tacgccgacgaggtcaccctggggcgcgccttcgagggacgcctccatgtgggagttggt
gcctga

DBGET integrated database retrieval system