KEGG   Propionibacterium acnes 266: PAZ_c02830Help
Entry
PAZ_c02830        CDS       T01971                                 

Gene name
folE
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
paw  Propionibacterium acnes 266
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:paw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315538..316113
Genome map
AA seq 191 aa AA seqDB search
MKLSVDRERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTF
DISHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQ
VQERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRGILRNPATR
AEAMGLITAGR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtccgttgatcgcgagcgagccgcggcagctatccgcgagtttcttctggcg
gtcggcgaggatcccgatcgggaaggcctgcgcgatactccaatgcgagtggcccaggcg
gccgaggagctatttggcggattgagccaagatccgggggagttgctggcaacgaccttc
gacatctcccacgacgagatggtgttggtgcgtgatattgagttgcagtcgatgtgtgag
caccatctgctgcccttcatcggggtagcgcacgtcggttatattccggctagggacggc
cgggtgacggggttgagtaagatcgcgaggttggtggaggtctatgcgcgtcgaccccag
gtacaggagaggttgacgacccaggtggccgacgccttggtagaacatttggacgctcgt
ggcgtgatcgtggttgttgaggccgagcacatgtgcatgacgacgaggggggtccgcaag
ccgggggcccggacggtgacctccgcggtgcgcgggattctgcgcaacccagcgacgcgg
gccgaggcgatggggctgatcacggctggacgttga

DBGET integrated database retrieval system