KEGG   Propionibacterium acnes 266: PAZ_c03220Help
Entry
PAZ_c03220        CDS       T01971                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
paw  Propionibacterium acnes 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAZ_c03220
Enzymes [BR:paw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PAZ_c03220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(348757..349482)
Genome map
AA seq 241 aa AA seqDB search
MTTNPADLVKPPVVVPRDDSHDKFVTTLKQAGYGVIHTALTRTVTLPDAERLTAPDLWQA
DWLVVTSKTTVGLLPTPLPNPNIKVAAVGAATSAALRTRGIDVDFVPENHSGAGLVAEWP
GGVASILLPASQLTADTVPLGLTKVGCTVNRLEIYTTAAVEKLPEVIAQSWPSVGVVVVT
ASSVGRALVELVEPLGWRRQKLVALGKPTARTLEVLGHPAHAVASSPTPEAVLEAVESLV
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaatcctgccgatctcgtcaagcccccagttgttgttccccgtgacgactcc
cacgacaaattcgtgacgactttgaagcaggccggttatggagtgatccacacagcgctg
acgcgcaccgtcaccttgccggatgcggagaggcttactgcccctgacctgtggcaggcc
gactggctggtcgtcacctcgaagaccaccgtcggactgctccctaccccgttgccgaat
cccaacatcaaagtagctgcggtcggcgccgctacctctgctgcgctgcgcacacgtggg
attgacgtcgacttcgtccccgagaatcacagcggcgctggtctggtcgccgagtggcca
ggtggagtcgccagtatcctcctaccagcgtcccagttaaccgccgataccgtaccgctg
gggctgacgaaggtcggctgcacggtaaaccgattggagatctataccaccgctgccgtc
gagaaactgcctgaggtcatcgcccagtcgtggccgtctgtcggggtcgtcgtcgtcact
gcctcctcggtgggacgtgccctcgtcgagctggtggagccgctgggatggcgtcgtcag
aagctcgtcgccctcggtaagcccactgcaagaacactcgaagtactcggtcacccagcg
catgcggtggcctcctcccccactcctgaagccgtccttgaggcggttgagtccttggtc
gcctga

DBGET integrated database retrieval system