KEGG   Propionibacterium acnes 266: PAZ_c03810Help
Entry
PAZ_c03810        CDS       T01971                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paw  Propionibacterium acnes 266
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAZ_c03810 (gpmA)
   01230 Biosynthesis of amino acids
    PAZ_c03810 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAZ_c03810 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PAZ_c03810 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAZ_c03810 (gpmA)
Enzymes [BR:paw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PAZ_c03810 (gpmA)
Exosome [BR:paw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PAZ_c03810 (gpmA)
  Exosomal proteins of melanoma cells
   PAZ_c03810 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(407066..407815)
Genome map
AA seq 249 aa AA seqDB search
MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLKQENLLPDIVHTSLLR
RAIHTAYLALDGCDRHWIPVHRSWRLNERHYGALQGLNKAETKEKYGNDQFMAWRRSYDV
RPPDLDRDSEFSQFHDPRYADIPASERPVAECLKDVVARMVPYFTSDIAADLKDGKTVLV
AAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLKPVTRGGRYLDPEAAAAGA
KAVANQGNK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagctcatcctgctccgccatggcgagagcgaatggaactccaagaacctc
ttcaccggctgggtggacgtcgatctcaacgagaagggcgagggcgaggctcgtcacgcc
gccgacctgctcaagcaggaaaacctcctgcccgatatcgtccacacctcgctgctacgt
cgtgctatccataccgcctacctagcccttgacggctgcgaccgccattggatcccggtg
catcgctcctggcgcctcaacgagcgtcactacggtgcgctgcagggtctcaacaaggct
gagaccaaggagaagtacggcaacgaccagttcatggcttggcgtcgctcctacgatgtt
cgtccaccggaccttgaccgcgacagcgaattcagccagttccatgacccgcggtacgcc
gacatcccggcgtccgagcgtccggtcgccgagtgtctcaaagacgtcgtggcccgcatg
gtgccgtacttcacctctgatattgctgccgaccttaaggacggcaagacggtgctcgtg
gctgctcacggtaactccctgcgcgccctcgtcaagcacctcgacgagatcagtgacgag
gacatcgccggcctcaacatcccgaccggtatcccgctgttctacgagcttgacgacaac
ctcaagcccgtgactagggggggccgctacctcgaccctgaggccgctgccgccggcgcc
aaggcagtcgctaaccagggaaacaagtga

DBGET integrated database retrieval system