KEGG   Propionibacterium acnes 266: PAZ_c05550Help
Entry
PAZ_c05550        CDS       T01971                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
paw  Propionibacterium acnes 266
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:paw00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572947..573609
Genome map
AA seq 220 aa AA seqDB search
MAPTFTSINRSRSLVGWLEDQLTQRAPSWQRPRCVGSLTPPEELQPLAAQLGSDVPFCLT
GGVALGRGRGDRLAPVICRGRHRWVFATSNQGLSTPAVYRRFDELGGTPGGETVPNDLIS
ALTRGDLDAVAASLSNDLQAAAIDLRPELEEVLTVGREVGALTALVSGSGPTCAFLVRDT
AGAKKVSAAVSNLPQVHRTRTARGPAAGAQLLPGPVGSFA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgacattcacatcgataaatcgatcccggtcgctggtgggatggctggaggat
cagctgacgcagcgggcgccctcatggcagcggccgcgctgtgtcggctcccttactccc
cccgaggaattacaaccgttggctgctcagcttggctccgacgtgcccttctgtctcacc
ggtggagtggcgttagggcgaggtcgaggagaccgtcttgcgccagtgatctgccgagga
cgtcatcgctgggtgttcgcgacatcgaatcagggactgtccaccccggctgtctaccga
cgtttcgacgagttgggcggcacccctgggggagaaacggtgcccaatgacctcatctcg
gccttgacccgcggcgatcttgatgctgtcgctgccagtttgagcaatgacttacaggcc
gctgccatcgaccttcggcccgaactcgaagaggtgttgacggttgggcgagaggtgggt
gcgttgaccgctttggtttctggatcggggccgacctgcgccttcctcgtccgggacacc
gctggcgccaaaaaggtgagcgctgctgtgtccaatctgcctcaggttcatcgcacccga
actgcccgcggtccagctgcgggagcgcagctcctgcctggcccggtggggagctttgca
tga

DBGET integrated database retrieval system