KEGG   Propionibacterium acnes 266: PAZ_c06460Help
Entry
PAZ_c06460        CDS       T01971                                 

Gene name
fucI1
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
paw  Propionibacterium acnes 266
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PAZ_c06460 (fucI1)
Enzymes [BR:paw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     PAZ_c06460 (fucI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663636..664211
Genome map
AA seq 191 aa AA seqDB search
MGVCADLTVTASWDCIAEILDLTPDIPHARGFNATERSGAVTVAAAMAAYTQLGILAFAI
YGHDVQNADDALTDDVSARILSFGRAALAVGLMRVRSYLAMGTVSMGIAGCHVPEQALQD
YLGMRSQYIDMVELGRRITAGIYDHVEWKWAMAWVSASVRTEIRLTSSTAMLTSVNSWSI
RSRWCWLPETS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctgtgcggatctcaccgtcaccgcctcgtgggactgcatcgccgaaatcctc
gacctgactccggacattccgcacgcgagggggttcaacgccactgaacgttctggagcc
gtcaccgtggctgcggccatggcggcctacacacagctgggtattctggccttcgccatc
tacggtcatgatgttcagaatgccgacgacgccctcactgacgacgtctcggcccggatt
ctcagcttcggacgagccgccctggcagtcgggctcatgagagtccggagctacttggcg
atgggcaccgtgtcgatgggcattgccggatgtcatgtccctgagcaggcccttcaggat
tacttgggcatgcgcagccagtacatcgacatggtggaactcggccgcaggatcaccgcg
ggtatctatgaccacgttgagtggaagtgggcgatggcatgggtctcagcatcggtgagg
accgaaatccggctgacaagcagcacagcgatgctgacaagcgtgaacagctggagtatt
cggtcaagatggtgctggttgcccgagacctcatga

DBGET integrated database retrieval system