KEGG   Propionibacterium acnes 266: PAZ_c06470Help
Entry
PAZ_c06470        CDS       T01971                                 

Gene name
fucI2
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
paw  Propionibacterium acnes 266
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:paw00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664220..665149
Genome map
AA seq 309 aa AA seqDB search
MRLADMGFKEEAGGYDAIAAGFQGKRQWTDGKLNGDVMETLLNTSFDSDGLRQPQVFATE
GDALNGIAMLLGSLLTQRPQFFSDVRTYWSPEAVRRVTGHELTGRAAGGFVDFRNSGAST
LNATECEAEADGTPVIKHWWDLTEDDIQADLAATTFHSATQEYFPGGGFSTHFTTVGDTT
VTAVRMNMVAGVGPTLQIVEGRTLPDEGTDTIVERADPTWPTTFFVSRIPSSGAFSSVYD
WMDKWGANHTSTGYSHIGADVLTLAAMLRIPVSMHNIETKDIFRPRTWSSSEPSSNRRAR
DTDRRVRPS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtctggccgacatgggattcaaggaagaggccggtggttacgacgccatcgccgcc
ggcttccagggcaagcgtcagtggactgatggcaagctgaacggcgacgtcatggaaacc
ctgctcaacaccagcttcgactcggatggactgcgtcagccccaggtctttgccaccgag
ggagatgccctcaacgggatagcgatgctgctcggcagcctcctcactcagcgtcctcag
ttctttagcgatgtccgtacctattggagcccggaggccgttcgccgcgtcaccggtcat
gagctgaccggtcgtgccgctggtggtttcgtcgatttcaggaattccggcgcgagcact
ctcaacgcgacagaatgcgaggccgaggcggacggcactcccgtcatcaagcactggtgg
gatctcaccgaggacgacatccaggccgatctcgctgcgacgaccttccactcggcgacc
caggagtacttcccgggcggcggattctcgacccacttcacgacggtgggggacacgacg
gtgacagcggttcgtatgaacatggtcgctggagttggaccgaccctgcagattgtcgag
ggacggacgctcccggacgaggggacagacaccatcgttgagcgggcggacccgacgtgg
ccgacaacgttcttcgtgtcgcgcattccctcgagcggagccttcagtagcgtttatgac
tggatggataagtggggagctaaccacacctcgacggggtacagccatatcggcgctgac
gttctcaccctggcagccatgctgcgcatcccggtctcgatgcacaacattgagaccaag
gacatcttccgtccgcgtacctggtcctcgtcggaaccgtcgtcgaaccgccgtgcgagg
gataccgaccgacgagtgaggccctcatga

DBGET integrated database retrieval system