KEGG   Propionibacterium acnes 266: PAZ_c07720Help
Entry
PAZ_c07720        CDS       T01971                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
paw  Propionibacterium acnes 266
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAZ_c07720 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAZ_c07720 (glkA)
   00052 Galactose metabolism
    PAZ_c07720 (glkA)
   00500 Starch and sucrose metabolism
    PAZ_c07720 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    PAZ_c07720 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PAZ_c07720 (glkA)
   00524 Butirosin and neomycin biosynthesis
    PAZ_c07720 (glkA)
Enzymes [BR:paw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PAZ_c07720 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786057..787127
Genome map
AA seq 356 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDESGQIVRRIQRLTPSRSPEAVEDAIVESVRELARNLPICAV
GIGAAGWIDTEQALVRFSPHLAWRNEPLRDRLSERITVPVLVDNDANAAAWAEFRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDARALLAEGAPGAQDLLGYVADRNPGNLIGPDVTRAAVDGDRLAIELIADIGIW
LGRGMANLAAALDPDLFVIGGGVSAAGDLLLEPARTVYARTLTGRGFRPMADIQKAHFGN
DAGLIGAADLARHSINEPPGMARGFWPRRRTAVRKPRRTLRQSLSETLAGPVVRDK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttagcgttggcatagatattggcggcacgaaggttgccgctggtgtcgtagatgaa
agtggccagattgttcggcgtattcagcgcctgacaccctcgcgcagccccgaggctgtt
gaggacgctatcgttgagtcggtccgtgaattggctcgtaacctccctatctgtgctgta
ggcatcggggcagccggctggatagacactgaacaggcgctcgtgcggttttccccgcat
ttagcatggcgtaatgagccgctgcgcgatcgtctgtctgagcgcatcactgtgcctgtt
ctcgtcgataatgacgccaatgcggccgcgtgggctgagttccggttcggagccggacaa
ggatcacgggtcatggtgtgcctgacgttgggaacgggtatcgggggtgcactcgttatc
aatgggcggatgttccgcggccgatacggcatggccggagaattcggacatatgacggtg
gttcccgatggccactggtgcccatgtggcaaccgtggttgctgggagcaatacgcttcc
ggaaattccctcgtgagggatgctcgagcgttgcttgccgagggagctcccggtgctcag
gatctgttgggttatgtagctgaccgcaatccgggcaacctcattggtcctgatgtcaca
cgcgcagcggtcgatggcgatcgtcttgccattgagctcattgcagacattggcatctgg
ctgggccgtggaatggcgaacttggcagcagccttagatccagatctctttgtcattggt
gggggagtgagcgccgccggagacctcttgcttgaacctgcgcgcactgtatatgcccgc
acgctgacgggccgggggttccgcccgatggccgatattcagaaggcacatttcggtaac
gatgctgggcttatcggcgccgcagacttggctcgccactccatcaacgaaccgccgggc
atggctcgcgggttctggccacgtcgtcgtactgctgtccgcaagccacgccgtactttg
cgtcagagcctgagtgaaactctcgccggtccggttgttcgggacaagtga

DBGET integrated database retrieval system