KEGG   Propionibacterium acnes 266: PAZ_c08380Help
Entry
PAZ_c08380        CDS       T01971                                 

Gene name
bchI
Definition
magnesium-chelatase 38 kDa subunit (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
paw  Propionibacterium acnes 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAZ_c08380 (bchI)
Enzymes [BR:paw01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PAZ_c08380 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857636..858457)
Genome map
AA seq 273 aa AA seqDB search
MPTISQVDDVYHLSADEQHIYGDPLGVPSCTNLQLRQVPVVELPVGVTEDRVAGTLDVET
ALVRGQQRFQPGLLASAHRGILYVDEVNLLDDHIVDILLDSAAMGVNTVEREGMSVIHPS
RFSLVGTMNPEEGQLRPQLLDRFGLCVTVQGETDPEVRMEIVQRRLSFEDDPDGFITEWS
SHSRRLAERIENAMTLVQSVEIPKNILSTAVQICLDSNIDGHRGDITIIHAARALAAWAG
RDRIIQDDLEKVAPLVLNHRLQYASGVARAPRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccatttctcaggttgacgacgtttatcatctaagcgctgatgagcaacatatc
tacggagatcctttaggggttccaagctgcacgaatctacagcttcggcaagttccagta
gtggagctaccggttggggtcaccgaagacagggttgccgggacacttgacgtagaaaca
gccttagtccgggggcagcaaaggttccagccaggcctgctagcgtcggcacaccgagga
atactgtacgtcgatgaggtcaatcttcttgacgatcacatcgtcgacatcttgctggat
tctgcagctatgggagtgaataccgttgaacgggaaggcatgagcgtgatccatccatcc
cgtttcagcttggtaggaacgatgaatcccgaagaaggccagctacgtccacaattgctg
gatcggttcggactgtgcgttacggtccagggagagaccgatcccgaggtacggatggag
atcgtacaacgtcgactatcattcgaagacgatccggatggatttattacagaatggtcc
tcgcatagcagacgattagccgaacgcatcgaaaatgccatgaccctagtccaatccgtc
gagattccgaaaaatattctttccacagcggtacagatctgtctggattccaacatcgac
ggccatcgaggcgacatcaccatcattcacgccgcaagagccttagcagcgtgggcggga
cgagaccgaattattcaggacgatctcgaaaaagtcgcccccctggtcctcaatcatcgg
ttacaatatgcgtcgggcgtcgcgcgggctccacgcggatag

DBGET integrated database retrieval system