KEGG   Propionibacterium acnes 266: PAZ_c09470Help
Entry
PAZ_c09470        CDS       T01971                                 

Definition
acetyl-coenzyme A ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
paw  Propionibacterium acnes 266
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAZ_c09470
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAZ_c09470
   00620 Pyruvate metabolism
    PAZ_c09470
   00640 Propanoate metabolism
    PAZ_c09470
  Energy metabolism
   00680 Methane metabolism
    PAZ_c09470
Enzymes [BR:paw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PAZ_c09470
Lipid biosynthesis proteins [BR:paw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAZ_c09470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
966714..967517
Genome map
AA seq 267 aa AA seqDB search
MCFGDAWVRKHDLSSLRVLGSVGESINPEAWRWFHDVVGDGTCPITDTWWQTETGMFQIT
TVPSMPLKPGAVGRPVFGQEAAVVDEEGHELPAGKEGFLVLKNPWPAMMRTLYKDPDRYL
EAYWTKYPGVYLTGDSARIDDDGYIWIIGRADDVIKVSGHRIGTAEVESALIFHPAVAEA
AAIGLPHEVKRNAIHMVVVLNHSFEPTKNLVSDIRGHVAETLSPIAKPDTIEFVDKLPKT
RSGKIVRRVLKARVLGGDEGDLSTLED
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtgctttggcgacgcctgggtgcgcaaacacgatctgtccagtttgcgcgtactcggt
tcggttggcgagtccatcaacccggaggcttggcgctggttccacgacgtggtcggtgac
ggcacgtgtccgatcaccgatacctggtggcagaccgaaactggcatgttccagatcacc
actgtgccgtcgatgccgctcaaaccaggtgccgttgggcgtccggtctttggccaggag
gctgctgttgtcgacgaggagggccatgagctccctgcgggcaaagagggcttcctcgtc
ctcaaaaacccgtggccggccatgatgcgcaccctgtataaggatccggatcgatacctc
gaggcgtactggacgaagtacccgggtgtctatctcaccggtgattccgcacgaatcgat
gatgacggctacatatggatcatcggacgtgctgacgacgtcatcaaggtatccggtcac
cgcatcggtactgctgaggtggagtccgctctgatctttcaccccgccgtcgccgaggct
gcggccatagggctgcctcacgaagtgaagcgcaacgcgatccatatggtcgttgtactc
aatcatagtttcgagccgacgaagaatctcgtctctgatatccgcggacacgtcgccgaa
accctctcgccgattgccaagcctgacaccatcgagttcgtcgacaagttgccgaagacc
cgctccggcaagatcgtgcgtcgcgtcctcaaagctcgtgtcctgggtggagacgaggga
gacctgtcaaccctagaggactga

DBGET integrated database retrieval system