KEGG   Propionibacterium acnes 266: PAZ_c11800Help
Entry
PAZ_c11800        CDS       T01971                                 

Gene name
trpB
Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
paw  Propionibacterium acnes 266
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:paw01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:paw00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:paw00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1203276..1204532
Genome map
AA seq 418 aa AA seqDB search
MSARDLPDARGHFDRFGGRFVPEALQAALSQLTGTFEAAVTDPDFLTELEDLRREYAGRP
SPLTEAPRFSQYIFQQTGHQVRVLLKREDLNHTGSHKINNVLGQALLTRKMGKRRLIAET
GAGQHGVATATVAAMMGMECRIYMGQIDTERQALNVARMQLLGAEVIAVEAGSRTLKDAM
NEAMRDWVAHVEDTHYLIGTASGPHPFPKLVREFQRVISAEARQQCLDRVGRLPDAICAC
VGGGSNAIGSFAEFIDDPEVRLYGFEAGGDGVETGRHAASITRGSVGVLHGTRTYILQDP
DGQTMESHSISAGLDYPGVGPEHSWLAARKRATYLPVNDREAMEALRTLTRTEGIMPAIE
SAHAVAGVLKIAKDLPAHDGEPSVVIVTVSGRGDKDVDTALKWFAMDGSVDATTGGME
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacgagacttgcccgacgctcggggacacttcgaccgtttcggtggccgattc
gttccagaagctctccaagctgctcttagccagcttacggggaccttcgaggccgcggta
accgatcctgactttctcactgagctggaggatctgcgccgggagtacgccggacgcccc
tctccgcttacagaggcaccgcgattttctcaatacatctttcaacagaccggtcatcag
gtgcgagtccttctgaagcgcgaggacctgaaccacaccggttctcacaagatcaacaat
gtgttgggccaagccctgctgactcgaaagatgggcaagcgccgtctcattgcggagacg
ggagctggacagcatggcgtggcgacggcaaccgtggccgcgatgatgggcatggagtgc
cggatctatatgggccagatcgacactgagcgtcaggccctcaatgtggctcgcatgcag
ctgttgggcgccgaggtcattgcagtggaagccggctcgcgcacgttgaaggacgccatg
aacgaggccatgcgagattgggtggcccatgttgaggacacccactacctcatcggtacc
gcttctgggccacacccgttccctaaactggtgcgagagtttcagcgggtcatttctgcg
gaggcccgtcagcagtgccttgatcgggttggacgccttcccgacgccatttgtgcgtgt
gtcggtggtgggtcgaatgccatcggatcgttcgccgagttcatcgacgaccccgaggtt
cgtctctacggtttcgaggcgggcggtgacggtgtcgagaccggtcgccatgcagcatcg
atcaccaggggttccgttggtgtactgcacggcactcgcacctacattctgcaagatccg
gacggccagacgatggaatctcactccatatcggccggcctggactatcccggagttggc
cccgaacattcttggttagcggcccggaagcgtgctacttacctcccggtcaacgaccgc
gaggccatggaggctctacgtaccctcacccgcaccgaaggcatcatgccggccattgag
tcggcccacgctgtcgccggcgttcttaagatcgcgaaagacctgcctgctcacgacggc
gagccgtcagtggtcatcgtcacggtgtcgggtcgcggggataaagatgttgacactgcc
ctgaagtggtttgccatggacggcagcgtcgacgccactacgggaggtatggaatga

DBGET integrated database retrieval system